Dataset for protein BAX-like of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|G1K8X4_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Anolis carolinensis GN=BOK (length=215 residues).
MKMDVLRRSSVFAAEVMEVFDRTPTDKELVSQAKVLCRDFIHSRLIRAGIGWNKPEHSVPVPGGKLAEVSNILLRLGDEL
EYIRPNLYRNVARQLNISLHSETVVTDAFLAVATQIFSSGITWGKIVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFV
RKTLVTWMKRRGGWSDITKCVVNTDPNLRSHWLVAAICSFGHFLKAIFFVLLPER
>gnl|bcl2dbpro|G1KSN2_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Anolis carolinensis GN=BAK1 (length=214 residues).
MASRNGNDPTDRRRTEIRRPSMEIALEDQVAQETEEVFQSYAFYRYQQEREQTEGDVPHDPEIAAIPHEPNSTNCQVGRR
LATIGDDINARYDKEFSEMLKSLQPTKDNAYEYFIRIASSLFESGINWGRVIALLGFGYRMAIHVYQHGMTGFLRRIARY
MADFVLRNRIARWIAQQGGWVAALDLSNVYLKYVLIVAAVILLGQFVVRRFFNP
>gnl|bcl2dbpro|H9G9C2_BAX-01 BCL2-associated X protein OS=[Eukaryota] Anolis carolinensis GN=BAX (length=147 residues).
GAEASPDAAAVTSLQDCMFRIWQELSSNRDLTSMVESATGKNPLEVLADVSEHLFADGINWGRIVVFFYFAFRVIAQVKK
KEAKNPESIEDVVSWAMTFLQNHLANWIQQQGGWEGLLSYFGTPTWQTIAVFAAGVLTASLTFWKMS
>gnl|bcl2dbpro|H9GPC1_BAX-01 BCL2-associated X protein OS=[Eukaryota] Anolis carolinensis GN=BAX (length=207 residues).
MAAAAADPGRSREAGAPPRKAGTSSDQILQTGTVLLKGFIWDRVQSCGDSERIQATLAELKESESRICDPKTKQLSECLR
RIGDELDGNMELQSMIEQVQVYPPKEVFFRVAAEMFSDGTFNWGRVVALFYFACKLVLKAICTKLPELIKTIISWTMEYI
KNHVLTWIQAQGGWEGLLSYFGTPTWQTIAVFAAGVLTASLTFWKMS
© 1998-2019