Dataset for protein Bax of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|H9G9C2_BAX-01 BCL2-associated X protein OS=[Eukaryota] Anolis carolinensis GN=BAX (length=147 residues).
GAEASPDAAAVTSLQDCMFRIWQELSSNRDLTSMVESATGKNPLEVLADVSEHLFADGINWGRIVVFFYFAFRVIAQVKK
KEAKNPESIEDVVSWAMTFLQNHLANWIQQQGGWEGLLSYFGTPTWQTIAVFAAGVLTASLTFWKMS
>gnl|bcl2dbpro|H9GPC1_BAX-01 BCL2-associated X protein OS=[Eukaryota] Anolis carolinensis GN=BAX (length=207 residues).
MAAAAADPGRSREAGAPPRKAGTSSDQILQTGTVLLKGFIWDRVQSCGDSERIQATLAELKESESRICDPKTKQLSECLR
RIGDELDGNMELQSMIEQVQVYPPKEVFFRVAAEMFSDGTFNWGRVVALFYFACKLVLKAICTKLPELIKTIISWTMEYI
KNHVLTWIQAQGGWEGLLSYFGTPTWQTIAVFAAGVLTASLTFWKMS
© 1998-2019