Dataset for protein Bak1 of organism Anolis carolinensis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1KSN2_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Anolis carolinensis GN=BAK1 (length=214 residues).
MASRNGNDPTDRRRTEIRRPSMEIALEDQVAQETEEVFQSYAFYRYQQEREQTEGDVPHDPEIAAIPHEPNSTNCQVGRR
LATIGDDINARYDKEFSEMLKSLQPTKDNAYEYFIRIASSLFESGINWGRVIALLGFGYRMAIHVYQHGMTGFLRRIARY
MADFVLRNRIARWIAQQGGWVAALDLSNVYLKYVLIVAAVILLGQFVVRRFFNP
© 1998-2019