Dataset for protein Unclassified of organism Anas platyrhynchos platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U3IMW3_uncBAK1-01 Putative BCL2-antagonist/killer 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos (length=148 residues).
MSQTQRSPRHFVLSSYPEGDPEDEMYGNLLAAPDTAEQMEFNISSAVQVGHHLALIGDDFNRAYSRKIEDTLLHLAHGVA
VSVFQTWNIIKSITRRFGNILNNNWTKRIAGYGSWICRLPFRCVCQKLVPAALLAVAFWWAISYGLQN
© 1998-2019