Dataset for protein Bok of organism Anas platyrhynchos platyrhynchos

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|U3ISP2_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=BOK (length=213 residues).
MEVLRRSSVFAAEVMEVFDRSPTDKELVSQAKALCRDYINSRLVRAGVSWSKPECNAPVPGGKLAEVSTILLRLGDELEY
IRPNVYRNIARQLNISLHSETVVTDAFLAVAAQIFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRK
TLVTWLKRRGGWADITKCVVNTDPSLRSHWLVAAVCSFGHFLKAIFFVLLPER
© 1998-2019