Dataset for protein Unclassified of organism Anabas testudineus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q1I0M1_uncBCLWAV-01 Putative BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Anabas testudineus (length=145 residues).
MCQSEVPDTRLGLNSPDPLVREAFLMADHIDYVCTAALHHTVDELLTRFPIFFRCWPRIFNDVTEKTSCPILISILDEHF
FPQVLGGRCRDLAWSAVLSVYVLAGQMALHYHRRGMTVVLSQLKECVGAYMKRVICSEIQDKGGL
>gnl|bcl2dbpro|A0A3Q1I2H2_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Anabas testudineus (length=200 residues).
MACEGNGLSDERIGEALIREVIEDQLKDIPSEDVPPLTPLVKVKNDQEQKVVAQLAAMVRIVGDRMHTDRAFQDAIDGIA
RNSNSKWDKFREVADKVFEHGITWERIAVLIYVAGKLAVKMVEAHLPQSVREILKWTVEFFKNNLLGWIWEHGGWISSFS
ELAKSSMQSMSCMGSLNYGWVFIFVAGLGLGSFITWRLTR
© 1998-2019