Dataset for protein Bok of organism Anabas testudineus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q1I4R6_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Anabas testudineus GN=BOK (length=213 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNGLGWSKTELNLSPSNAALADVSLVLLCLGDELEC
IQPSLWRNVARQLNISVAMENMVSDAFIGVATEIFSTGITWGKVVSMYAVAGALAVDCVRQGHPSTVHIIVDSLGQFVRR
FLVPWLKRRGGWAEISKCVVKKDLSPEHHWLSSVIESLKYFLTTMYVCIMKEP
>gnl|bcl2dbpro|A0A3Q1I9F7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Anabas testudineus GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWSKPEHGLAASGGALGEISSVLLWLGDELEYLRP
NIYRNVARQLNIPVASEGVVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAIVHTIVDCMGEFVRKSLT
SWLKKRGGWVDLTKCVVNTDPSFCSHWLVSAAFAFGYYLKAIVLHLLREK
© 1998-2019