Dataset for protein BAX-like of organism Anabas testudineus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A3Q1I4R6_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Anabas testudineus GN=BOK (length=213 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNGLGWSKTELNLSPSNAALADVSLVLLCLGDELEC
IQPSLWRNVARQLNISVAMENMVSDAFIGVATEIFSTGITWGKVVSMYAVAGALAVDCVRQGHPSTVHIIVDSLGQFVRR
FLVPWLKRRGGWAEISKCVVKKDLSPEHHWLSSVIESLKYFLTTMYVCIMKEP
>gnl|bcl2dbpro|A0A3Q1I5B7_BAX-01 BCL2-associated X protein OS=[Eukaryota] Anabas testudineus GN=BAX (length=205 residues).
MADSREEEKKDGDEEPQGAVGGEDVVDDSIMEQAAVVLRGFVIERLSTDDPGQQVSPEQLGGRPNEQQDPQIKDVVDQLI
KIAEELNRNAELQQLINQVQSNCAHDVFMTVVRSIFADGINWGRVVALFHLAYRLIHRALTTNHLDNIRMVFNWFLEVIR
ELLYSWLVQQGGWVGVIRGFSRWRTVAIAASVILVATFVYYRKTR
>gnl|bcl2dbpro|A0A3Q1I5B7_BAX-02 BCL2-associated X protein OS=[Eukaryota] Anabas testudineus GN=BAX (length=190 residues).
MADSREEEKKDGDEEPQGAVGGEGMFVIERLSTDDPGQQVSPEQLGGRPNEQQDPQIKDVVDQLIKIAEELNRNAELQQL
INQVQSNCAHDVFMTVVRSIFADGINWGRVVALFHLAYRLIHRALTTNHLDNIRMVFNWFLEVIRELLYSWLVQQGGWVG
VIRGFSRWRTVAIAASVILVATFVYYRKTR
>gnl|bcl2dbpro|A0A3Q1I9F7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Anabas testudineus GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWSKPEHGLAASGGALGEISSVLLWLGDELEYLRP
NIYRNVARQLNIPVASEGVVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAIVHTIVDCMGEFVRKSLT
SWLKKRGGWVDLTKCVVNTDPSFCSHWLVSAAFAFGYYLKAIVLHLLREK
>gnl|bcl2dbpro|R9Y0N7_BAX-01 BCL2-associated X protein OS=[Eukaryota] Anabas testudineus GN=BAX (length=192 residues).
MASYPGGGDQGNTKDQILEVGCVLLKDFIYERIQRHGDASTAVTRAQLGGGELCDPNHKKLAQCLQQIGDELDANVDLQR
MINDSSLSPTKDIFMKVALEIFSDGKFNWGRVVALFYFACRLVIKAVVTQVPDIIRTIISWTMDYLREHVINWIREQGGW
EGIRSYFGTPTWQTVGVFLAGVLTTVLVIRKM
© 1998-2019