Dataset for protein Unclassified of organism Amphiprion percula

[Download (right click)]

4 sequence(s)

>gnl|bcl2dbpro|A0A3P8RQE3_uncBAX-02 Putative BCL2-associated X protein OS=[Eukaryota] Amphiprion percula (length=201 residues).
MASEGNGMSDERIGTALIKQVIEEELKDVPSEDVPPLTPLAVQLKTEQEEKVVNQLGIMIRIVGDKVKDDKEFQDAIDGM
ACGPGSKWDRFKKVTDKVFEHGITWENIAVLFYVAGKLALKMVEAHLPQSVRDVLMWTVDFFRNNLLGWIRDHGGWINSF
SDLAVASVQHVSSFSSQSYGLIIIFISGLALGSFITWRFSK
>gnl|bcl2dbpro|A0A3P8RQE3_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Amphiprion percula (length=195 residues).
MASEGNGMSDERIGTALIKQVIEEELKDVPSEDVPPLTPLAVQLKTEQEEKVVNQLGIMIRIVGDKVKDDKEFQDAIDGM
ACGPGSKWDRFKKVTDKVFEHGITWENIAVLFYVAGKLALKMVEAHLPQSVRDVLMWTVDFFRNNLLGWIRDHGGWVRWT
FFLFLLSLGHFSLPSALRYELTLIIYLCYVPRIRG
>gnl|bcl2dbpro|A0A3P8TBF2_uncBCLWAV-02 Putative BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Amphiprion percula (length=203 residues).
MCQLEVPEARLGLNSPDPLVREAFLMAHDYIDYVTRGGADGTMGPAPTACTAALRHAGDELLTRFPIFFRRWPRVFQDVT
EDTACPMLMSILDEHFFPPIPGGRRRDLAWSAVLSVYVLAGQMALHCQERGMLAVLPQLKECVGAYVDRVICPEIRDRGG
WTGFVSRFGEKQDLEGQLKKACWWTLLALAISIITYFFIKRMA
>gnl|bcl2dbpro|A0A3P8TBF2_uncBCLWAV-01 Putative BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Amphiprion percula (length=203 residues).
MCQLEVPEARLGLNSPDPLVREAFLMAHDYIDYVTRGGADGTMGPAPTACTAALRHAGDELLTRFPIFFRRWPRVFQDVT
EDTACPMLMSILDEHFFPPIPGGRRRDLAWSAVLSVYVLAGQMALHCQERGMLAVLPQLKECVGAYVDRVICPEIRDRGG
WTGFVSRFGEKQDLEGQLKKACWWTLLALAISIITYFFIKRMA
© 1998-2019