Dataset for protein Bok of organism Amphiprion percula

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P8RKE4_BOK-02 BCL2-related ovarian killer protein OS=[Eukaryota] Amphiprion percula GN=BOK (length=208 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWSKPEHGLAASGGTLGEVSGVLLWLGDELEYLRP
NVYRNVARQLNITVASESIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
SWLKRRGGWLYKRKTTISSPMQTGLGYAQLSREICQETLQTSQALHGV
>gnl|bcl2dbpro|A0A3P8RKE4_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Amphiprion percula GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWSKPEHGLAASGGTLGEVSGVLLWLGDELEYLRP
NVYRNVARQLNITVASESIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
SWLKRRGGWADMTKCVVNTDPSFRSHWLVSAVCAFGHYLKAVVLYLLREK
>gnl|bcl2dbpro|A0A3P8SEB1_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Amphiprion percula GN=BOK (length=213 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNGLGWSKTEINFGPSNAALAEVSLVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMYAVAGALAVDCVRQGHPTTVHILVDSLGQFVRK
FLVPWLKRRGGWAEITKCVVKKDLTPEQNWFSSTVESLTYFLTTMYVYIMKEP
© 1998-2019