Dataset for protein Bax of organism Amphiprion percula

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P8RS99_BAX-01 BCL2-associated X protein OS=[Eukaryota] Amphiprion percula GN=BAX (length=205 residues).
MSDSRDEEKSPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTEDPSRHVSSEDLGGRPDELQDPQIKEVVDQLL
KIADELNRNAELQRLINQVQGNCAQDIFMKVARSIFADGINWGRVVALFHLAYRLIYKALTTNHLENIRMVISWVLQVIR
EQLYAWLVQQGGWEGVIRSFSRWRAAAIVASVVLVATFVYLRRTR
>gnl|bcl2dbpro|A0A3P8TFP0_BAX-01 BCL2-associated X protein OS=[Eukaryota] Amphiprion percula GN=BAX (length=192 residues).
MASHPGGGDQGNGKEQLVEVGAALLKDFIFERVQRHGDGKTVVTRAQLGGGELVDPSHKKLGQCLQQIGDELDGNVELQR
MINDSSLSPTKDVFLKVAVEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPDIIRTIIHWTMDYLREHVINWIREQGGW
EGIRSHFGTPTWQTVGVFLAGVLTTVLVIRKM
© 1998-2019