Dataset for protein BAX-like of organism Amphiprion ocellaris

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q1ANM8_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Amphiprion ocellaris GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRTGIGWSKPEHGLAASGGTLGEVSGVLLWLGDELEYLRP
NVYRNVARQLNITVASESIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
SWLKRRGGWADMTKCVVNTDPSFRSHWLVSAVFAFGHYLKAVVLYLLREK
>gnl|bcl2dbpro|A0A3Q1AZQ5_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Amphiprion ocellaris GN=BOK (length=213 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNGLGWSKTEINFGPSNAALAEVSLVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMYAVAGALAVDCVRQGHPTTVHILVDSLGQFVRK
FLVPWLKRRGGWAEITKCVVKKDLTPEQNWFSSTVESLTYFLTTMYVYIMKEP
>gnl|bcl2dbpro|A0A3Q1CKY3_BAX-01 BCL2-associated X protein OS=[Eukaryota] Amphiprion ocellaris GN=BAX (length=192 residues).
MASHPGGGDQGNGKEQLVEVGAALLKDFIFERVQRHGDSKTVVTRAQLGGGELVDPSHKKLGQCLQQIGDELDGNVELQR
MINDSSLSPTKGVFLKVAVEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPDIIRTIIHWTMDYLREHVINWIREQGGW
EGIRSHFGTPTWQTVGVFLAGVLTTVLVIRKM
>gnl|bcl2dbpro|A0A3Q1CTC5_BAX-01 BCL2-associated X protein OS=[Eukaryota] Amphiprion ocellaris GN=BAX (length=205 residues).
MSDSRDEEKSPGEQEPQGAVGGEDVIDDPILEQGAVVLRGYVIERINTEDPSRHVSSEDLGGRPDELQDPQIKEVVDQLL
KIADELNRNAELQRLINQVQGNCAQDIFMKVARSIFADGINWGRVVALFHLAYRLIYKALTTNHLENIRMVISWVLQVIR
EQLYAWLVQQGGWEGVIRSFSRWRTAAIVASVVLVATFVYLRRTR
© 1998-2019