Dataset for protein Unclassified of organism Amphimedon queenslandica

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A1X7VMB9_uncBAK1-01 Putative BCL2-antagonist/killer 1 protein OS=[Eukaryota] Amphimedon queenslandica (length=251 residues).
MATGGREGGQAELSRRRQAFRTGATDSLDELSEEERRETERALYEYVFRRAEKDEKLSRDEVESFREAEINKARTESEAT
SESDGGGGGESNAKAVGRRLAELGDEIDSMYSGHFEDIMQMYSDNPDQAFVTFSTVLQNVFEWDEFGLPKLNVGRIAAVL
GYCYHLCKNYISKYFSSSGLLSVLAVIASFLVKFFLKAKFYDMLKRVGGWGQLIQLPAASVLNRIASTPNFFLVVGVASL
AIYAFQYFRGR
>gnl|bcl2dbpro|A0A1X7VNS3_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Amphimedon queenslandica (length=247 residues).
MASKMLSPQISPSDFEDEEELHSVPEDIRNQTQVMFYEYVDSRCSHDRDLSKEQASLLHESASTCIRKTDVGGQGEAAER
IAILLCEYGDKFQKEFDNDQNLQKLMTEGTSDTDTGEPSTSSVLAHVRIVVERIFGVNSNGEIMVQNITFGRIASLFYYI
YSLCKRFLKNTFANHTLMQTMCALGGYLVVSLVRVKFFQWLKDQGGWGQAIVNISTSITLPTWGNNVILAGGVFLIGLWA
YRMYKGL
© 1998-2019