Dataset for protein Unclassified of organism Amphilophus citrinellus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q0RW67_uncBCLWAV-01 Putative BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Amphilophus citrinellus (length=164 residues).
CHGGYILNTLFPKIKNQTMGSAPTACTAAIRHAGDELLACFPIFEHWPRIFQDMTENSAHGTVLSEYVLAGQVAIYCQEP
GVLQLEECVGAYVERHLARTFCLVFGEKQDLEWHLKCVDSLATSIHTYFFWKRISWPTLPPTDLKQKLQESNTTKCLQCI
CSFL
>gnl|bcl2dbpro|A0A3Q0SNX2_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Amphilophus citrinellus (length=181 residues).
FTALIEEELKDVPSEDIPPLTPLTEVKTEQEKKMVMQLSKMIRIIGDRVQDDKDVIDGVASAPGSKSDNFRQVANKVFAD
GITWEKIAVLIYVAGRLAVKMVEAHLPQSVREVLSWTVSFFRNNLLSWVQEHGGWINSFSELAVVSMQSVSVSSHSYGLI
IIFIAGMAIGSLITWRLSRQS
© 1998-2019