Dataset for protein Bax of organism Amphilophus citrinellus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q0R008_BAX-01 BCL2-associated X protein OS=[Eukaryota] Amphilophus citrinellus GN=BAX (length=204 residues).
MYSIIASVLCSRNHCIRALENLRSEDADMLTFLHCIHHMYVITRINTEDPSRHVTSEDLGGRPDEQQDPQIKEVVDQLRK
IADELNRNAELQGLINQVQGNCAQDIFMAVARNIFADGINWGRIVALFHLAYRLIYKALTTNHLENIRMVISWVLQVIRE
QLHTWLVQQGGWEGVIGSFSRWRTVAIVASVALVVAFVYYRKVR
>gnl|bcl2dbpro|A0A3Q0S1T8_BAX-01 BCL2-associated X protein OS=[Eukaryota] Amphilophus citrinellus GN=BAX (length=174 residues).
EVGTILLKDFIYERVRRHGDSNTVVTREQLGGTQLTDQNHKRLAQCLQQIGDELDGNVELQRMIDDSSLSPTKDIFLKVA
IEIFSDGKFNWGRVVALFYFACRLVIKALVTQIPDIIRTIIVWTMDYLREHVINWIREQGGWEGIRSYFGTPTWQTVGVF
LAGVLTTVLVIRKM
© 1998-2019