Dataset for protein Bok of organism Ailuropoda melanoleuca

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G1MDG6_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BOK (length=191 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKAPAPVPGGRLAEVCAVLLRLGDELELIRPSVYRNVARQLNISLQSETV
VTDAFLAVASQIFSGGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLAPWLRRRGGWTDVLKCVVST
EPGFRSHWLVAALCSFGRFLKAAFFVLLPER
© 1998-2019