Dataset for protein BAX-like of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|G1L3H7_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BAK1 (length=216 residues).
MASGQGPGPPRQECGETAPSSTSASEEQVARDTEEVFRSYVFYRHRQEQEAEGAAAPADPEMVSLSLEPSSTMGQVGRQL
AIIGDDINQRYDSEFQTMLQHLQPTAENAYEYFTKIASSCSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTR
FVADFMLHHCIARWIAQRGGWQVAALNLGNGPILNVLIVLSLVLLGQFVVRRFFKS
>gnl|bcl2dbpro|G1M7S3_BAX-01 BCL2-associated X protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BAX (length=192 residues).
TRREAEQPRGRGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALEQVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
>gnl|bcl2dbpro|G1MDG6_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BOK (length=191 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKAPAPVPGGRLAEVCAVLLRLGDELELIRPSVYRNVARQLNISLQSETV
VTDAFLAVASQIFSGGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLAPWLRRRGGWTDVLKCVVST
EPGFRSHWLVAALCSFGRFLKAAFFVLLPER
© 1998-2019