Dataset for protein Unclassified of organism Acanthochromis polyacanthus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q1EA77_uncBAX-01 Putative BCL2-associated X protein OS=[Eukaryota] Acanthochromis polyacanthus (length=203 residues).
MASEGNGMSDERIGTALIKHVIEEELKDVPSEEFPPLTPLAVQLNNEQEEKVVNQLSKMIRIIGDSVKGNEEFQDAIDGM
ARDPGSKWDKFKKVTDKVFEYGISWENIAVLFYVAGKLALKMVEAHLPQSVRDVLMWTVDFFRNNLLGWIRDHGGWINSF
SDLAVASVHQVSSFSSRSYGRFTIFISGLVLGSFITWRLTKSL
>gnl|bcl2dbpro|A0A3Q1FXE4_uncBCLWAV-01 Putative BCL2 homolog found in water-living anamniote vertebrates protein OS=[Eukaryota] Acanthochromis polyacanthus (length=203 residues).
MCQLEVPEARLGLNSPDPLVREAFLMAHDYIDYVTRGGADGTMGPAPTACTAALRHAGDELLTRFPIFFRRWPRVFQDVT
ENTACPMLMSILDEHFFPPVPGGRRRDLAWSAVLSVYVLAGQMALHCQERGMLAVLPQLKECVGAYVDRVICPEIRDRGG
WTGFVSRFGEKQDLEGQLKKACWWTLLALAISIITYFLIKRMT
© 1998-2019