Dataset for protein Bok of organism Acanthochromis polyacanthus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q1F1K1_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BOK (length=210 residues).
MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWSKPEHGLAASGGTLGEVSSVLLWLGDELEYLRP
NVYRNVARQLNITVASESIVSDAFLAVAADIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLT
SWLKKRGGWADMTKCVVNTDPSFRSHWLVSAVCAFGHYLKAVVLYLLREK
>gnl|bcl2dbpro|A0A3Q1FIY9_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BOK (length=213 residues).
MEVLRRSSVFAAEVLDVFDRSLTEKELVSQSKALCRDYILSRLNQNGLGWSKTEINFGPSNAALAEVSLVLLCLGDELEC
IQPSLYRNVARQLNISVAMENMVSDAFIGVATEIFSAGITWGKVVSMYAVAGALAVDCVRQGHPTTVHILVDSLGQFVRK
FLVPWLKRRGGWVSITKCVVKKDLAPEQNWFSSTVESLKYFLTTMYVYIMKEP
© 1998-2019