Dataset for protein Bax of organism Acanthochromis polyacanthus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q1FSZ4_BAX-02 BCL2-associated X protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BAX (length=205 residues).
MSGSRDEDKPPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTEDPSRHVSSEDLGGRPDELQDPQIKEVVDQLL
KIADDLNRNAELQRLINQVQGNCAQDIFMKVARSIFADGINWGRVVALFHLAYRLIYKALTTNHLENIRMIISWVLQFIR
EQLYVWLVQQGGWEGVIRSFSRWRTAAIVASVVLVATFIYLRRTR
>gnl|bcl2dbpro|A0A3Q1FSZ4_BAX-01 BCL2-associated X protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BAX (length=204 residues).
MSGSRDEDKPPGEQEPQGAVGGEDVVDDPILEQGAVVLRGYVIERINTEDPSRHVSSEDLGGRPDELQDPQIKEVVDQLL
KIADDLNRNAELQRLINQVQGNCAQDIFMKVARSIFADGINWGRVVALFHLAYRLIYKALTTNHLENIRMIISWVLQFIR
EQLYVWLVQQGGWVSGTSSVKFCPVCLFKAFWSPAWTCSGIQSS
>gnl|bcl2dbpro|A0A3Q1FXV2_BAX-01 BCL2-associated X protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BAX (length=192 residues).
MASHPGGGDQGNGKEQLVEVGAALLKDFIFERVQRHGDGNTVVTRAQLGGGELVDPNHKKLGQCLQQIGDELDGNVELQR
MINDSSLSPTKDVFMKVAVEIFSDGKFNWGRVVALFYFACRLVIKALVTQVPDIIRTIIHWTMDYLREHVINWIREQGGW
EGIRSHFGTPTWQTVGVFLAGVLTTVLVIRKM
© 1998-2019