Dataset for protein Unclassified of organism all

[Download (right click)]

22 sequence(s)

>gnl|bcl2dbpro|A0A3Q1G016_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Acanthochromis polyacanthus (length=173 residues).
MDDEEEDMSRPISQLWGTSFGDVKFEDRATQITAGQAFASHDNNSINALPCGLHRQPHIPFHGNAGLRSHFPAQFEPMED
RGEREVEEEEEEGRGEDNERMAERPEEQAGVSVEAQIGRKLREIGDKFHQDHVELFMRHQRQNLPVWMRLTMALFGFLFP
REAHVPRLRGAQR
>gnl|bcl2dbpro|A0A3Q0RUR2_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Amphilophus citrinellus (length=178 residues).
LARPPKPSDGPTAVTASEDSGGDPPPVCATGAQTSRLNRESTGGGEPDSPSWARTPTSFAAYQSRTIFRFPRRSSSGYFS
MECDSMPSSPLSPKPMMADKAIQTPSLSSQVLTHALQRMGEVRDEGPETNQQQGEHRQMCVFVYYDTQCRNLSVNLKKES
SASPNGFQVYILGSIFIS
>gnl|bcl2dbpro|A0A3Q0SC56_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Amphilophus citrinellus (length=140 residues).
MDDEEDDVFKPKARCWHTTFRQIKCEHRGTQTPGPALVPNNGMLPCFRLHFPARFELVGDHEARQQESEEQPNRMERLPR
QRPVARGVEACIGQKLQLIGDQFHRERLQLGPLWWRLAAALLSLLFDRGFFAGGGGAGRR
>gnl|bcl2dbpro|A0A3P8RSQ3_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Amphiprion percula (length=171 residues).
MDDEEEDMSRPISQPRGTSFGDVKFEDRATQIAAGQALAAVTAAVSTSQSHNNNSINALPCGLHRQPHIPFHGNAGLRSH
FPAQFEPMEDRGEREVEEEEEEGRGEDNDRMAERPEEQAGVSVEAQIGRKLREIGDKFHQDHVELVSLTAELWTRSTINC
PLQTPHSRAQS
>gnl|bcl2dbpro|A0A3Q1HMF6_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Anabas testudineus (length=142 residues).
MDDEEEDMSRPISQHWGTPFRDVKYEDLPTQISAGQALAGITARQPHIPFHGKKGLHVEPARHREDDDRMAQRPEDQAGV
SVEVQIGRKLREIGDKFQQDHLELFVRHQRQNLPIWMRLTMALFGFLFPREALIPRLRGEQR
>gnl|bcl2dbpro|B6IM60_uncEGL1-01 Putative Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis briggsae (length=134 residues).
MDSRFQFSSSSSCFNRPTKLSKNVKFEFSSQEIALDRFNTTRMEPFFSIGHTIGKQLSKLCDDFDKEMMAHAHKTSIVAT
VKSLWNVMFTNFSPQEAFCFDVKNKNSRTRRHCSVIAKRCRVLFSKVFNFIIKC
>gnl|bcl2dbpro|Q9TY06_uncEGL1-01 Putative Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis elegans (length=98 residues).
MMSYKRDGYFSIVSSCLIFCLHFLPLLSIRTKLSSLFITSLANNACNSNTVEYNIGRKLTVMCDEFDSELMSYKEEKSFV
KFLGSGFKTYASIVRRVF
>gnl|bcl2dbpro|A0A3G3M2I9_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Carassius auratus (length=88 residues).
MSDTSEVWFAEPSHQHVQMAAPVGAMGPEISVARELRRIGDEFNRLYCQGAGAGGNNRAQLHAPNEHAIIMWMNDLIGRV
VQFFLRRR
>gnl|bcl2dbpro|A0A3P8UBL4_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Cynoglossus semilaevis (length=116 residues).
MRRKGEFISARAPTGRSVECQREGGRAEERKSPQSTDKRVRSLFTDSVPSSPRPVTADKATQTPSPSAQVINHALLSVAE
TQRTNGERLRQIHPEREWPLTCVCVCGFVFLYLCGR
>gnl|bcl2dbpro|A0A3P8W5W5_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cynoglossus semilaevis (length=87 residues).
MKQEFRIKPEYTENMMNKLLFTPSLLSCPGSRICLFPLRHCCGGCNTESQLEMVCPPFQLSAFSTACPVVLPLTPLTQSR
REDSRWY
>gnl|bcl2dbpro|A0A3Q2FS95_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Cyprinodon variegatus (length=242 residues).
MNDMQSSRPPNLRDGSTEVTSEEGTEGDPAASARKPRLSKRRERSCALQPGAAGTAGGGRDPDSDSPPCSVSPASLDVFR
SRSIFRPTRRSSSGYFSFDCDSLPSSPLTPHPVTADKATQTASPTGQVMKHALQRMAVEQGGQGAPGLHGHSAIPYSEWE
GIAARDMQSETFGRQLRTIGDEYNNHLLRMAGRHRRNIVPLNLMPHIQQEPVAMLCVGLLLLLIGRIMYLQGSTSSHDHP
QV
>gnl|bcl2dbpro|A0A2R8RYV1_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=226 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLVRVIHIRLILFFKAAGFQMCVVRNWWFQSRCKMTSLSAISVLNMQIPKREQ
>gnl|bcl2dbpro|Q0GKC4_uncBMF-02 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=226 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLVRVIHIRLILFFKAAGFQMCVVRNWWFQSRCKMTSLSAISVLNMQIPKRER
>gnl|bcl2dbpro|Q0GKC4_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=208 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLFTQRGQMGLFQLMTSIYNFLFPQERPQNARAHR
>gnl|bcl2dbpro|A0A3P8ZI98_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Esox lucius (length=159 residues).
PDSAFIDKLSKCVHVSSTSSLSALGRPLQGDQDPRHRRRRQAGQVHSDFHWVFGTPVRGTEHRGPTRHHQPHRAHIHVPF
TGNAGFRSHFPAEFEPMDDRGEGMEERQEEEQVEDSVEERIGRKLREIGDQFHEDHVQLVRVKQMCIQGWNHLFSDILF
>gnl|bcl2dbpro|A0A452H537_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Gopherus agassizii (length=87 residues).
MCPCALHGGPPAACPCSSARRGARFSGAQLVAARLKLVGDELQERTAWRRASSRRAAAGRSLATYLCLLCAASQVAALVW
LIRKRSW
>gnl|bcl2dbpro|A0A3Q4AXL5_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Mola mola (length=145 residues).
MPYKNKIDTRSPCDCFHAVFPPPSCAAGAPAQISRSDNGGERRSSGFGEPDSPSWRGIIPVDSLGVFQTIFHLPRSLSIG
YFSADGDSLPTSPLSPRPPTADRATQTPSLSGQAMQHALQRMAGLCGGEPGTTGLIRQMWDIQPM
>gnl|bcl2dbpro|G1PFC4_uncBIK-01 Putative BCL2-interacting killer protein OS=[Eukaryota] Myotis lucifugus (length=80 residues).
MSQAGHLSRSLILCTFLQEHGLQAVEDPGVTSLLQYSPEPLGPRRALPHEVAMRLAFIGDELEVRWTLPRFAHVPWMAMY
>gnl|bcl2dbpro|W5P3K2_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Ovis aries (length=43 residues).
MWRRRARGGGAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
>gnl|bcl2dbpro|A0A3B4DQ45_uncBBC3-01 Putative BCL2 binding component 3 protein OS=[Eukaryota] Pygocentrus nattereri (length=186 residues).
MARPQMDSRVDSQSPTAPQSCRMEVLRRDAWPSGGTHSASQARHRHRTMATQTSPVLLSHARTQDAASLPNTNQQDGPLR
DNTGTEPERSSSAETQQPLHDLTAESHSSSADSSRRESPAEEEPTPEEQAIHRVAIQLRTIGDDMNAVYLQRRNEAPQWQ
NWRGLYRGLVAFLADTISTLYQHGVR
>gnl|bcl2dbpro|A0A3B4XK57_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Seriola lalandi dorsalis (length=139 residues).
MDDEEEDMSQPISNLWGTSFRDVKYEDRATPIAAGQALTAVTAAPLILFVWWVPHWELSPSTKMNMLRFSENRPEEQAGV
SVEAQIGRKLREIGDKFQQDHFMRHQRQNLPAWMRLTMALFGFLFPRQALVPRLRGEQR
>gnl|bcl2dbpro|A0A3B5B3B7_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Stegastes partitus (length=221 residues).
SDESPGSRCPTEGSGADPEPAGAAGASAQKSRSNEERSVGQRSSAGGEPDSPPWCPASLGVFQTRSIFHLPRRSSSGYFS
ADGADSVPSSPLFLKRLTADKATQTRSPSGQVIEHAMGRMADEAHEAVGRALRRIGDDYDRILMVRVRDGQCLCVCVSEE
GCGHRQQPPADTFVQMLTKVLKTAVEQLFCQILLYFIFFFIMVGYLSSSNVKPHVETGGVK
© 1998-2019