Dataset for protein Unclassified of organism all

[Download (right click)]

7 sequence(s)

>gnl|bcl2dbpro|B6IM60_uncEGL1-01 Putative Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis briggsae (length=134 residues).
MDSRFQFSSSSSCFNRPTKLSKNVKFEFSSQEIALDRFNTTRMEPFFSIGHTIGKQLSKLCDDFDKEMMAHAHKTSIVAT
VKSLWNVMFTNFSPQEAFCFDVKNKNSRTRRHCSVIAKRCRVLFSKVFNFIIKC
>gnl|bcl2dbpro|Q9TY06_uncEGL1-01 Putative Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis elegans (length=98 residues).
MMSYKRDGYFSIVSSCLIFCLHFLPLLSIRTKLSSLFITSLANNACNSNTVEYNIGRKLTVMCDEFDSELMSYKEEKSFV
KFLGSGFKTYASIVRRVF
>gnl|bcl2dbpro|A0A2R8RYV1_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=226 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLVRVIHIRLILFFKAAGFQMCVVRNWWFQSRCKMTSLSAISVLNMQIPKREQ
>gnl|bcl2dbpro|Q0GKC4_uncBMF-02 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=226 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLVRVIHIRLILFFKAAGFQMCVVRNWWFQSRCKMTSLSAISVLNMQIPKRER
>gnl|bcl2dbpro|Q0GKC4_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio (length=208 residues).
MDDEEDEQLPRCCETPLRNKRSEKRDAHGGDVGQTAHRHASTQTAGSVLNSARDADMAPFQGSQREASSLCRVVGARTAF
RAPCGTGGLVSLTMGPGARGGPRALFHGNAGFRAHFPALFEPALDGLQNAEQREQDEGRPEEKEEDRDAGISVEVQIGRK
LREMGDQFQQEHLQLFTQRGQMGLFQLMTSIYNFLFPQERPQNARAHR
>gnl|bcl2dbpro|G1PFC4_uncBIK-01 Putative BCL2-interacting killer protein OS=[Eukaryota] Myotis lucifugus (length=80 residues).
MSQAGHLSRSLILCTFLQEHGLQAVEDPGVTSLLQYSPEPLGPRRALPHEVAMRLAFIGDELEVRWTLPRFAHVPWMAMY
>gnl|bcl2dbpro|W5P3K2_uncHRK-01 Putative Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Ovis aries (length=43 residues).
MWRRRARGGGAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL
© 1998-2018