Dataset for protein Noxa of organism all

[Download (right click)] [Alignment] [Repertoires]

46 sequence(s)

>gnl|bcl2dbpro|G1LIZ7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=PMAIP1 (length=54 residues).
MPGKKARKSAQASPARTRGQPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A2K5CFK7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Aotus nancymaae GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPSRAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|F7GW45_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Callithrix jacchus GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|Q1PCT2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Canis lupus familiaris GN=PMAIP1 (length=54 residues).
MPGRKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFRQKLLNLLSKLFRSGT
>gnl|bcl2dbpro|A0A286XF37_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cavia porcellus GN=PMAIP1 (length=102 residues).
MPGKVCKSAQPNSTRAELEVECAAQLRRVGDTLNSLGCTTEALEVLAEMAGKKARKSSEPDPARARAELEVECAAQLRRI
GDKLNFQQKLMYLISKLISLVT
>gnl|bcl2dbpro|A0A2K5NJZ2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cercocebus atys GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPMRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A0D9S003_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5JY52_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5JY52_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=PMAIP1 (length=124 residues).
MPGKKARKNAQPSPARAQAGTDPLGPAKTQAGRGRGRGKKLLSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAET
SESDSQTLLLRNLTATKTCMRGLQKRIFLRRCTFHQFEARLHCN
>gnl|bcl2dbpro|A0A0P0HZF9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ctenopharyngodon idella GN=PMAIP1 (length=45 residues).
MAKKEKTAVVECAQQLRTIGDLFDWKYKLLEIIIALQKAQTDGKR
>gnl|bcl2dbpro|Q0GKC8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Danio rerio GN=PMAIP1 (length=45 residues).
MAKKEQTAVVECAQQLRNIGDLLNWKYKLLELIVTLQKIQMEGKR
>gnl|bcl2dbpro|A0A1D5PAR2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gallus gallus GN=PMAIP1 (length=54 residues).
MMPGRTIRKPAPPAAPAERDAVAECALELRRIGDKADLQQKVLNLITKLFCPKT
>gnl|bcl2dbpro|A0A2I2YVQ5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2I2YVQ5_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=PMAIP1 (length=150 residues).
MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIEMQLRFTRGKKLLSSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTE
LPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNWEECEGAFMGALGNGRWNTSK
>gnl|bcl2dbpro|Q13794_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Homo sapiens GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|Q13794_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Homo sapiens GN=PMAIP1 (length=136 residues).
MPGKKARKNAQPSPARAPAGPAGTAGTARDQAGFAIGMQLRFTRGKKLLSSSLSSSPLALPRGHEEQVQVAGSRVCYSTQ
EIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCN
>gnl|bcl2dbpro|G3T0P7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Loxodonta africana GN=PMAIP1 (length=58 residues).
MPGKKARKSAQPGPAGTPAGTQQRDVVECAIQLRRIGDKINFRQKLLNVICKLFCSGT
>gnl|bcl2dbpro|A0A2K5VPX2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca fascicularis GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5VPX2_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca fascicularis GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW
>gnl|bcl2dbpro|A0A1D5QGJ8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca mulatta GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAAGTAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIW
RQTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCN
>gnl|bcl2dbpro|A0A2K6BV75_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca nemestrina GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGPAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIWR
QTKLPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K6BV75_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca nemestrina GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5ZWH1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5ZWH1_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHFTRGKKLVSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCILHKFEERLHCNW
>gnl|bcl2dbpro|A0A1U7QLK6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mesocricetus auratus GN=PMAIP1 (length=105 residues).
MLQSVARQNAPSNPARAELAPEFIAQLRRIGDKLSSEWCEPDIIAVLAEMPGKKARKSVTRIPSPTRVPTDVEDECVHQL
RRIGDKQNLRQKLLNFISKLFSLVT
>gnl|bcl2dbpro|Q9JM54_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus musculus GN=PMAIP1 (length=103 residues).
MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRR
IGDKVNLRQKLLNLISKLFNLVT
>gnl|bcl2dbpro|G1P8F9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Myotis lucifugus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAPAEAEIECALQLRRIGDKLSFLQKLLNLMYKLFGSGT
>gnl|bcl2dbpro|A0A2I3HX97_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Nomascus leucogenys GN=PMAIP1 (length=53 residues).
KPGRARRNAQPSPAPAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|W5P738_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ovis aries GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLIAKLLRSGT
>gnl|bcl2dbpro|A0A2R9AKC9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan paniscus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2R9AKC9_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan paniscus GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLSSSSSSPLALPRGHEEQAQVAGSRVCYSTQEIWR
QTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2I3SX38_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan troglodytes GN=PMAIP1 (length=134 residues).
MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLSSSLSSWPLALPRGHEEQVQVAGSRVCYSTQEIW
RQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2I3SX38_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan troglodytes GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A096MPU8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Papio anubis GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHFTRSKKLVSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETSESDSQTLLLRNLTASKTCIGGLQKRLFLRRCTLHQFEERLHCNW
>gnl|bcl2dbpro|A0A096MPU8_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Papio anubis GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|H2NWG2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pongo abelii GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2K6EM90_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Propithecus coquereli GN=PMAIP1 (length=54 residues).
MPVKKARKNAQPSPTRTRAEIEEECALQLRRLGDKLHFQQKLLNLIAKLFRSGT
>gnl|bcl2dbpro|Q5U777_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rattus norvegicus GN=PMAIP1 (length=105 residues).
MPGRKARRNAPLNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITAVLAQMPGKKSRKSTMRRSPSPTRVPADLKDECDQL
RRIGDKVNLRQKLLNFISKLFNLIT
>gnl|bcl2dbpro|A0A2K6KJF2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus bieti GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K6KJF2_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus bieti GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFTRGKKLLSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K6NC45_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFTRGKKLLSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K6NC45_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K6S6C4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPADLEVECAIQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A287AZR7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=72 residues).
LSKETFMAKGKVLFASMPHRSSNKNTQTNPLRLALPPLPAVKCRIGLRRVGTKLAIRQQITNFIIFFFFLGP
>gnl|bcl2dbpro|F1SMU1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=121 residues).
ARAAAGAPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPT
RVALPPDPEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT
>gnl|bcl2dbpro|Q9GL49_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=176 residues).
MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGSFGPPPAAVRGNQPTSEAFGRSGCCFSSSLP
LARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQFRRIGDKLNF
RQKLLNLIAKLFRLGT
© 1998-2018