Dataset for protein Hrk of organism all

[Download (right click)] [Alignment] [Repertoires]

24 sequence(s)

>gnl|bcl2dbpro|A0A2K5BYA0_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Aotus nancymaae GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|G3MWR6_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Bos taurus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPASGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|U3E722_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Callithrix jacchus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|E2RLD4_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Canis lupus familiaris GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLALRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPRALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A2K5KZ69_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Cercocebus atys GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCDCSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLSRRNL
>gnl|bcl2dbpro|A0A0D9SC73_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Chlorocebus sabaeus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A337SQ56_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Felis catus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|G3QTJ6_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Gorilla gorilla gorilla GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|O00198_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Homo sapiens GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|G3UH24_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Loxodonta africana GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLRRRNL
>gnl|bcl2dbpro|A0A1D5R1E4_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Macaca mulatta GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPASGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A2K6AYL7_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Macaca nemestrina GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A1U7R468_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Mesocricetus auratus GN=HRK (length=92 residues).
MCPCPRHRGHGPPAVCGCGDTRPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
>gnl|bcl2dbpro|F7G1G0_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Monodelphis domestica GN=HRK (length=98 residues).
MCPCPLHRGRGPPAVCACSSDRLEQRAAAAAQLTAARLKALGDELQERTMWRRRARSRRAAAEAAGSGGGGLPAYWAWLC
AAAHVAALAAWLLRRRNL
>gnl|bcl2dbpro|P62816_HRK-03 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Mus musculus GN=HRK (length=92 residues).
MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
>gnl|bcl2dbpro|G1QHD8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Nomascus leucogenys GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|G1T7W1_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Oryctolagus cuniculus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSAAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|H0Y001_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Otolemur garnettii GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALTTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|H2Q6Y8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Pan troglodytes GN=HRK (length=91 residues).
MCPCPLHRGRDPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A096N944_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Papio anubis GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|H2NIS8_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Pongo abelii GN=HRK (length=91 residues).
MCPCPLHRDRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A2K6GL98_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Propithecus coquereli GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALTTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|P62817_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Rattus norvegicus GN=HRK (length=92 residues).
MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCAAAQVA
ALAAWLLGRRSA
>gnl|bcl2dbpro|A0A287A5N9_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Sus scrofa GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSASRLGLRSSAAQLTAARLKALGDELHQRTMWRRSARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2018