Dataset for protein Bmf of organism all

[Download (right click)] [Alignment] [Repertoires]

149 sequence(s)

>gnl|bcl2dbpro|A0A3Q1FVH7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BMF (length=159 residues).
MDDEEDDVFEPDTHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELIARQQGSE
MEQNGMEQLPRQQPMAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLVAAILSLLFDGGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3Q1FVH7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BMF (length=159 residues).
MDDEEDDVFEPDTHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELIARQQGSE
MEQNGMEQLPRQQPMAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLVAAILSLLFDGGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3Q1D1K3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Amphiprion ocellaris GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGNHQARQ
QGSEMEQNGMEQLPRQQPVARSMEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAAVLSLLFDRGFIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3P8RKY9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Amphiprion percula GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGNHQARQ
QGSEMEQNGMEQLPRQQPVARSMEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAAVLSLLFDRGFIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3Q1IPR4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anabas testudineus GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCQDRGTQTPGPALPQNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDLEVRQ
QDSEEEQNGMEIPPRQQPLMQSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAAMLSLLFDRGLIAGGGGA
GRR
>gnl|bcl2dbpro|H9GL49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=222 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQIFFFLHNVALNMEANRHRAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI
>gnl|bcl2dbpro|A0A2K5E1W9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Aotus nancymaae GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K5E1W9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Aotus nancymaae GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYASAEPKSRVVAGPPLSAQPGFEWRREQEWGRPE
>gnl|bcl2dbpro|A0A3P8NFE2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Astatotilapia calliptera GN=BMF (length=170 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLVKASRIQTCWLETAEAYATPCKVHHSVITVWKPRG
LSQWQFLTVN
>gnl|bcl2dbpro|A0A3P8NFE2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Astatotilapia calliptera GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|A0A3B1K1X5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Astyanax mexicanus GN=BMF (length=155 residues).
MDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLFYGSAGLLLLAPSARSERVGDAMFR
EEHRAVEPRRRPAHSVEARIGQKLQMIGDQFYQEHMLQHRNQRNQQPLWLRLASALYTLLFEREPAAHGRREDRR
>gnl|bcl2dbpro|Q05KI3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Bos taurus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|Q05KI3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Bos taurus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|F7HPK0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Callithrix jacchus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|F7HPK0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Callithrix jacchus GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSHVVAGPPLPAQPGFEWRREQEWGRPE
>gnl|bcl2dbpro|J9PB65_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSFQLVPGISCSGAQQDCSCL
>gnl|bcl2dbpro|A0A452F2E0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Capra hircus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A452F2E0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Capra hircus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=189 residues).
VFPREMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSP
SSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQN
RNRAWWQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAW
WQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=236 residues).
MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGS
LLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPA
SFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAWWQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A2K5MJY6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cercocebus atys GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A2K5MJY6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cercocebus atys GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A0D9R4R5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Chlorocebus sabaeus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K5KGR6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Colobus angolensis palliatus GN=BMF (length=168 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGPQVRLGCPLHMGHQEHRQEGHRAGLTLCLVKL
FFCCYFAF
>gnl|bcl2dbpro|A0A2K5KGR6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Colobus angolensis palliatus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A3P8UA78_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cynoglossus semilaevis GN=BMF (length=173 residues).
MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHFPAHFELIGDRETRR
RQSDEERNRMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRLTTTLLSLLFN
RGFFAGGGAAGRR
>gnl|bcl2dbpro|A0A3P8UA78_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Cynoglossus semilaevis GN=BMF (length=173 residues).
MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHFPAHFELIGDRETRR
RQSDEERNRMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRLTTTLLSLLFN
RGFFAGGGAAGRR
>gnl|bcl2dbpro|A0A3P8UA78_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cynoglossus semilaevis GN=BMF (length=173 residues).
MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHFPAHFELIGDRETRR
RQSDEERNRMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRLTTTLLSLLFN
RGFFAGGGAAGRR
>gnl|bcl2dbpro|A0A3Q2E3E8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinodon variegatus GN=BMF (length=163 residues).
MEEEEDDVFEPDPNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYRNAGFRLHFPAHFELVGDFDVRR
QAEHNRMEQLPLQQPAALSLEACIGQKLQIIGDQFHREHLQQIPGQPFPHLVHQHQALTLPPLPVYFSLLSPVVPLCCGG
KWH
>gnl|bcl2dbpro|A0A3Q2E3E8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinodon variegatus GN=BMF (length=157 residues).
MEEEEDDVFEPDPNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYRNAGFRLHFPAHFELVGDFDVRR
QAEHNRMEQLPLQQPAALSLEACIGQKLQIIGDQFHREHLQQYHQNQRNQGPLWWRMTAALLSLLFDRGLIGGAGWR
>gnl|bcl2dbpro|Q0GKC7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio GN=BMF (length=142 residues).
MDEDEDDVFRKGLQHWPPPHLQIKQTELAGRPAGSRNGMLLCRHLQQHGHFLYGNAELLVLAASSRAQPPDVVLRQNVSP
MERPEPRPAQSVETLIGQKLQLIGDQFYQEHIMHHQRPQDPLWRRVATAVLTLLFGARENRR
>gnl|bcl2dbpro|F6TJI0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=227 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPSFQPGQEGVLWKSAGLQLPLSELLPFSPCCGTNGENLKQPVWLL
>gnl|bcl2dbpro|F6TJI0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=224 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPRCGKNVRGPVRELETSDLFLSCHPELPPAPGFCQDFVLSWS
>gnl|bcl2dbpro|A0A3P8ZIE7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Esox lucius GN=BMF (length=160 residues).
MEDEEDDVFEPDSYCWHTASREIKYEDRGTQTPTTALALLNDMLPCRLDQDPRPLFYGNAGFRLHFPAQFECVGDPGPQQ
RPQAVRGGMEHPQQLPQQPVARCIGQKLQLIGDQFHEEHLQLYHRNQRNLRPLWWRLASALLTLLWEQEAVAGGGRAGWR
>gnl|bcl2dbpro|M3WRS0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=130 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAKPPSSVVADSPLPTQPGFECRREQEWGRSQ
>gnl|bcl2dbpro|M3WRS0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|U3JS06_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ficedula albicollis GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQR
>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYHQNQRNQGPLWWRMTAALLSLLLDRGFVAGRGGAGRR
>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYHQNQRNQGPLWWRMTAALLSLLLDRGFVAGRGGAGRR
>gnl|bcl2dbpro|A0A3Q2PJX9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Fundulus heteroclitus GN=BMF (length=174 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQRGSFRSSLAAGEVGKPMYYTNVYSQCPTCWLANCLSRL
AAELLILCEFPTLL
>gnl|bcl2dbpro|A9XRG9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A9XRG9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A9XRG9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=200 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
VGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ
>gnl|bcl2dbpro|A9XRG9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=200 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
VGCFHRGRWGLSYLRVVLQKTGSRLRLSRLLPKAAAGYRQ
>gnl|bcl2dbpro|A9XRH0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=118 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHR
LHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A0A452H3N6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gopherus agassizii GN=BMF (length=192 residues).
MDPPNYLEDDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREALAEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFIHNLALNVEVNRNHVGQR
>gnl|bcl2dbpro|G3QIN5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|G3QIN5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|A0A3Q3C5V2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Haplochromis burtoni GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|A0A3Q2YCX7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Hippocampus comes GN=BMF (length=135 residues).
MEDEEDDVFEPDPHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGEQEERL
QESDDGMEQQLQQQQQQQPVARSIEACVGQKLQLIGDQFHREHLQLVSRNQHKHK
>gnl|bcl2dbpro|A0A3Q2YCX7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Hippocampus comes GN=BMF (length=135 residues).
MEDEEDDVFEPDPHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGEQEERL
QESDDGMEQQLQQQQQQQPVARSIEACVGQKLQLIGDQFHREHLQLVSRNQHKHK
>gnl|bcl2dbpro|Q96LC9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q96LC9_BMF-07 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|Q96LC9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q96LC9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q96LC9_BMF-06 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=163 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEHQQNQNRVWWQILLFLHNLALNGEENRNGA
GPR
>gnl|bcl2dbpro|Q96LC9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q96LC9_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Homo sapiens GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|I3MDS9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BMF (length=258 residues).
MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQC
VEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC
GVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQILLF
LHNLALNGDENRDRAGPR
>gnl|bcl2dbpro|I3MDS9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BMF (length=189 residues).
VFPEEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQN
RNRVWWQILLFLHNLALNGDENRDRAGPR
>gnl|bcl2dbpro|A0A3Q2ZA20_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Kryptolebias marmoratus GN=BMF (length=163 residues).
MDDEEDDVFEPDPSCWRTTFREIKCEDRGTQTPGPALVPHSGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIRDLEARQ
QDREEEPNRMERLPRQLPVARSLEVCIGQKLQLIGDQFHREHLQQYHRNQRNQGPLWWRLTAALLSLLFDRGFIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3Q3GUU5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Labrus bergylta GN=BMF (length=157 residues).
MDDEEDDVFEPDPHSWRTYFQEIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRPLFYGNAGFRLHFPANFELVGDQEESG
QESELQQIGMEQQQPVAHSVEASIGLKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALLSLLFDRGFIAGAGRR
>gnl|bcl2dbpro|W5N4P7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Lepisosteus oculatus GN=BMF (length=153 residues).
MEEDEDDVFHPSHFSHCWGTQFREIKYEDKGTQTPSPALVHGDNMLPCGVGAEPRRLFYGNAAFRLHFPAHFEQGGDEEE
ETGEAEEQPVRSAEVRIGQKLQRIGDQFHRDYLHMYRRNQRNHQPMWWRLALALFTFLFERQGNRNQLRGDQR
>gnl|bcl2dbpro|G3T7Z4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Loxodonta africana GN=BMF (length=268 residues).
MPRAGVFWKQYRTVLSLVHQRPPALAAAAVRSPRLPPLPAELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPETDTLSWS
HPGEMEPSQCVEELEDDVFQPEEGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADHFHRLHMQRHQQNR
NPAWRQILQFLHHLAVNGEENRNGAGPR
>gnl|bcl2dbpro|G7PAW6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca fascicularis GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|G7PAW6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca fascicularis GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|F7CM09_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPR
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K5Z4C3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mandrillus leucophaeus GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A2K5Z4C3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mandrillus leucophaeus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A3Q3LME3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=163 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLYHLNQRNQGLLWWRLATALLSLLFDRGFIAGGGRA
GRR
>gnl|bcl2dbpro|A0A3Q3LME3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=154 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLQVGWAPETSGSLPVLLACLTLITGVWREG
>gnl|bcl2dbpro|A0A3Q3LME3_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Mastacembelus armatus GN=BMF (length=167 residues).
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQLYHLNQRNQGLLWWRLATALLSLLFDRGFIAGGGRA
GRRPPCP
>gnl|bcl2dbpro|A0A3P9DPJ5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Maylandia zebra GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|A0A3P9DPJ5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Maylandia zebra GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|G1NHG8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Meleagris gallopavo GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A0A3Q3VLX6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mola mola GN=BMF (length=149 residues).
MDDDEDDVFEPEAHCWRTTFREIKCEDRGTQTPGPALAPYSGMLPCGVAEEPRHLFYVTSSLAPDSRDNCRERNGMERLP
RQQPVAHSVEACIGQKLQLIGDQFHREHMQLYHRNQRNQGPLWWRLGSALLSLLFDRGFFAGGGGAGRR
>gnl|bcl2dbpro|F6X3N6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Monodelphis domestica GN=BMF (length=184 residues).
MEPPHYVEELEDDVFHPEDSEPGAQPGGLTSAALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPASFPASLRLGEEPPEEQWEHRAEVQIAQKLQCIADQFHRLHMQRHQQNRNHVW
WQILLFLHNLALNREENRNGAGPR
>gnl|bcl2dbpro|A0A3Q3QZ16_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Monopterus albus GN=BMF (length=160 residues).
MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYGNAGFRLHFPAHFELVGDQEARR
QEDQNGMEHLPRQQRVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLATTLLSLLFDRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3Q3QZ16_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Monopterus albus GN=BMF (length=160 residues).
MDDEEDDVFEPDPHCWRTAFREIKCEDRGTQTAGPTLAPNNSMLPCGVAEDPRPLFYGNAGFRLHFPAHFELVGDQEARR
QEDQNGMEHLPRQQRVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLATTLLSLLFDRGFIAGGGGAGRR
>gnl|bcl2dbpro|A2AV74_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=271 residues).
MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLS
WSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLS
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
QNRDRAWWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|A2AV74_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=190 residues).
MSPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQ
NRDRAWWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|M3YAD5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mustela putorius furo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGDQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|G1PAU1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Myotis lucifugus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDELGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQWQHHRAEIQIARKLQSIADQFHRLQMQQHQQNRNRMW
WQFLLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A3Q4G1I4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Neolamprologus brichardi GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYQRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|A0A2I3HD83_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Nomascus leucogenys GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQEWGRP
>gnl|bcl2dbpro|I3K2D6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oreochromis niloticus GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRARR
QEIAEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAALLSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|G1SR62_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryctolagus cuniculus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPQSLLSADPFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPANFALGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHLQQHQQNRNRVW
WQILLFLHNLALNGDENRDGAGPR
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=169 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQRQSVVSD
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3I0V9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3P9JM16_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias latipes GN=BMF (length=163 residues).
MDDEEDDVFEPDPNKWRTTARKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEVRR
HDREAERRGMERLPRQQPVARSTEACIAQKLQLIGDQFHRERLQLYHRNQRNQGPVWWRLATALVSLLFDRGFIAGAGGA
GQR
>gnl|bcl2dbpro|A0A3B3CGR9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryzias melastigma GN=BMF (length=163 residues).
MDDEEDDVFEPDPNNWRTAVRKIKCEDRGTQTPGPALVPNNGMLLCGLAEEPRPLFYGNAGFRLHFPARFELAGDLEARR
HDREAERGGMERLPRQQPAARSTEACIAQKLQLIGDQFHRERLQLYHQNQRNQGPLWWRLTTALVSLLLDRGFIAGGGGA
GQR
>gnl|bcl2dbpro|H0WYH6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Otolemur garnettii GN=BMF (length=182 residues).
MEPSQCVEELEDDVFQPEDGELGTGNVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGV
MLPCGVTEEPQRLFYGNVGYRLPLPASFPAGLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQ
VLFFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|W5QFV1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ovis aries GN=BMF (length=188 residues).
LTGEMEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNR
NRMWWQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A2R9BS98_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Pan paniscus GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|A0A2R9BS98_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pan paniscus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2J8QDD5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Pan troglodytes GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2J8QDD5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pan troglodytes GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|A0A096NTE9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A096NTE9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=206 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGVDPRYKNARRSVRKLKASSFLSCQPE
>gnl|bcl2dbpro|A0A096NTE9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=196 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGVDPRPLTWNGAVVKPC
>gnl|bcl2dbpro|A0A3B3RH63_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BMF (length=146 residues).
MDDDDDDVFHTDPLTYQPPFRDIKCENRGTQTPGPALVQGLNMLPCGVGQEPRRLFYGSAGLRLHFPALSVPGGHPPQEE
RQPDDRPQPSAEVRIGQKLQMIGDQFHQDQLQLYHRNQRNQQPVWWRLVMALCGLLFERRQRAEQR
>gnl|bcl2dbpro|K7FRX2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pelodiscus sinensis GN=BMF (length=193 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQT
LSPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHEPPVGFALNPHLQEEPREGHQEARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQILLFLHNLALNVEANRNHIGQR
>gnl|bcl2dbpro|A0A3B4B6Y3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Periophthalmus magnuspinnatus GN=BMF (length=120 residues).
MEDEEDDVFEPDLHCWHTTFRQIKCEDRATQTPGPALAPNKGMLPCGVAEEPRPLFYAHFELGEDQEASESLQEGEMQNG
REPLPRHPVAVRSMEACIGHKLQLIGDQFHRDHLQRVREH
>gnl|bcl2dbpro|A0A096LRV0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia formosa GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3B3WU80_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia mexicana GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3P9Q8E2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia reticulata GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVRDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A2J8T301_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pongo abelii GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQSGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPTGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6FFR1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Propithecus coquereli GN=BMF (length=184 residues).
MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRMW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6FFR1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Propithecus coquereli GN=BMF (length=130 residues).
MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSHVVADPPLPTQPCFERRREQERGRSQ
>gnl|bcl2dbpro|A0A3B4ETH0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pundamilia nyererei GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|A0A3B4CNJ8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pygocentrus nattereri GN=BMF (length=155 residues).
MDEDEDDVFVMDTQYWRSSIREIKQEERGTQTPGRPPARPNGMLPCGVSEEPRRLFYGSAGLLLLAPSVRPEHVEGAMLQ
EDQLAMEPRRRPPHSVEARIGQKLQMIGDQFYQEHMLQHRNQRNQQPFWLRLASALYTLLFEREPVANGRRVDQR
>gnl|bcl2dbpro|Q8K589_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rattus norvegicus GN=BMF (length=185 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPVSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSALGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHMQQHQQNRDRA
WRQVFLFLQNLALNRRENREGVGPW
>gnl|bcl2dbpro|A0A2K6L933_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=204 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMCL
>gnl|bcl2dbpro|A0A2K6L933_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6L933_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6RAW8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus roxellana GN=BMF (length=123 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRRE
>gnl|bcl2dbpro|A0A2K6RAW8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus roxellana GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6TW86_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6TW86_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6TW86_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVAGPPLPAQPGFEWRRKQEWGRSE
>gnl|bcl2dbpro|G3WDQ2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sarcophilus harrisii GN=BMF (length=184 residues).
MESPHYVEELEDDVFHPEDSEPGAQPGGLTSPALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPANFPSSLRLGAEPPEEQWEHRAEVQIARKLQCIADQFHRLHMQRHQQNQNHVW
WQILLFLHNLALNREENRNGAGPR
>gnl|bcl2dbpro|A0A2U9CJH3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Scophthalmus maximus GN=BMF (length=217 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELFGDQEVRG
HESEEERSGMEQLPRQQQPVAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFLAGGGG
AGRRQAHTKRRAKASGPQNRASSVERTVQAMTNQFTSLPPQQLPPPANGRLPCALIG
>gnl|bcl2dbpro|A0A3B4U5H8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Seriola dumerili GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QGSGEERNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHQNQRNQGPLWWRLAVALLSLLFDRGLIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3B4UNJ0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Seriola dumerili GN=BMF (length=139 residues).
MDDEEEDMSQPISHLWGTSFRDVKYEDRATPIAAGQALTAVTAAPLILFVWWVPHWELSPSTKMNMLRFSENRPEEQAGV
SVEAQIGRKLREIGDKFQQDHFMRHQRQNLPAWMRLTMALFGFLFPRQALVPRLRGEQR
>gnl|bcl2dbpro|A0A3B4WM88_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAKEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QGSGEERNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHQNQRNHGPLWWRLAAALLSLLFDRGLIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3B5B8F6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Stegastes partitus GN=BMF (length=164 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGDHQARQ
QQGSEMEQNGMEQLPRQQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFIAGGGG
AGRR
>gnl|bcl2dbpro|A0A287AIU8_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=157 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQEFPSWLG
>gnl|bcl2dbpro|A0A287AIU8_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|H0ZMX5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Taeniopygia guttata GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQR
>gnl|bcl2dbpro|A0A3B5KWG6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Takifugu rubripes GN=BMF (length=147 residues).
MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGEAGDTLHYTGGAPNGMEPLPQQ
GPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWRLGTALLSLLFDRGFVAGGGGAGRR
>gnl|bcl2dbpro|A0A2U4BC98_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Tursiops truncatus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPAEGQWQHRAEVQIARKLQRIADQFHRLHMQQHQQNRNRVW
WQILLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A452SED0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ursus americanus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRDGAGPR
>gnl|bcl2dbpro|A0A384D070_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ursus maritimus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRDGAGPR
>gnl|bcl2dbpro|A3KND0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xenopus laevis GN=BMF (length=117 residues).
MDELDDDVFYPDAFGYPDQTITSSSLFNQSQSYTCLLGRFHLFPFSHCCGPGCRGTDNEDKATQTLGSPSQDIMLPCGVS
ETPQRLFYGKEALSEIYRMFNASIPHESHRFHRLFQV
>gnl|bcl2dbpro|F6TGJ4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xenopus tropicalis GN=BMF (length=181 residues).
QESYLNMDELDDDVFYPDEFGYPDQTMTSSTVFNQSQSYTCLLSRFHLFPLSHCCGPGCRGADYEDKATQTLGSPSISQD
IMLPCGVSETPQRLFYGHAGYLLYLPQNSPARFGEEVDNRRQEQSAEHRIARKLQCIGDQFHRFHLQRLQQNRNQFWSQI
LIFFRNLVMHPVGNRAGLAQR
>gnl|bcl2dbpro|A0A3B5QK08_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xiphophorus maculatus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEASIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3B5QK08_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Xiphophorus maculatus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEASIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR
© 1998-2019