Dataset for protein Bmf of organism all

[Download (right click)] [Alignment] [Repertoires]

88 sequence(s)

>gnl|bcl2dbpro|H9GL49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=222 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQIFFFLHNVALNMEANRHRAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI
>gnl|bcl2dbpro|A0A2K5E1W9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Aotus nancymaae GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K5E1W9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Aotus nancymaae GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQSEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYASAEPKSRVVAGPPLSAQPGFEWRREQEWGRPE
>gnl|bcl2dbpro|W5KM88_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Astyanax mexicanus GN=BMF (length=199 residues).
MCAFVFVYTFSGQECPDVGKAKSYLFWTSNVGTKLRWGAWKALLMDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRP
PARTNGMLPCGISEEPRRLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARIGQKLQMIGDQFYQEHM
LQHRNQRNQQPLWLRLASALYTLLFEREPAAHGRREDRR
>gnl|bcl2dbpro|Q05KI3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Bos taurus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|F7HPK0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Callithrix jacchus GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSHVVAGPPLPAQPGFEWRREQEWGRPE
>gnl|bcl2dbpro|F7HPK0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Callithrix jacchus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|J9PB65_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSFQLVPGISCSGAQQDCSCL
>gnl|bcl2dbpro|A0A286XXB0_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=189 residues).
VFPREMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSP
SSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQN
RNRAWWQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=236 residues).
MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGS
LLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPA
SFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAWWQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAW
WQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A2K5MJY6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cercocebus atys GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A2K5MJY6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cercocebus atys GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A0D9R4R5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Chlorocebus sabaeus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K5KGR6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Colobus angolensis palliatus GN=BMF (length=168 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGPQVRLGCPLHMGHQEHRQEGHRAGLTLCLVKL
FFCCYFAF
>gnl|bcl2dbpro|A0A2K5KGR6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Colobus angolensis palliatus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|Q0GKC7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Danio rerio GN=BMF (length=142 residues).
MDEDEDDVFRKGLQHWPPPHLQIKQTELAGRPAGSRNGMLLCRHLQQHGHFLYGNAELLVLAASSRAQPPDVVLRQNVSP
MERPEPRPAQSVETLIGQKLQLIGDQFYQEHIMHHQRPQDPLWRRVATAVLTLLFGARENRR
>gnl|bcl2dbpro|A0A1S3EQA2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Dipodomys ordii GN=BMF (length=181 residues).
IVPGEMEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQIARKLQCIADQFHRLHTQRHQQHRDRAWGQ
VLLFLHNLALNRENRDRAGPR
>gnl|bcl2dbpro|A0A1S3EQA2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Dipodomys ordii GN=BMF (length=176 residues).
MEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQIARKLQCIADQFHRLHTQRHQQHRDRAWGQVLLFL
HNLALNRENRDRAGPR
>gnl|bcl2dbpro|F6TJI0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus caballus GN=BMF (length=188 residues).
LTGDMEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNR
NRVWWQTLLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A1S3WU31_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Erinaceus europaeus GN=BMF (length=184 residues).
MELPQCVDELEDDVFQPEDGEPGTTPGSLLSSDLFAQSPMDCSLSRLQLFPLTHCCGPGLRPASQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPNSFPAGSPFAEQRREGQWQQRVEVQIARKLQCIADQFHHLHMQQHQQNRNPVW
WPFLLFLHNLALNEGENRNREAPR
>gnl|bcl2dbpro|M3WRS0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=130 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAKPPSSVVADSPLPTQPGFECRREQEWGRSQ
>gnl|bcl2dbpro|M3WRS0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Felis catus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRRRVW
WQILLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|U3JS06_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ficedula albicollis GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQR
>gnl|bcl2dbpro|A9XRG9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A9XRG9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A9XRG9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=135 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGKSTPTSPAFQQGNYPFSTSPVRQFLSLKL
>gnl|bcl2dbpro|A9XRH0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gallus gallus GN=BMF (length=118 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHR
LHIQRHQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|G3QIN5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|G3QIN5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|I3MDS9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BMF (length=189 residues).
VFPEEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQN
RNRVWWQILLFLHNLALNGDENRDRAGPR
>gnl|bcl2dbpro|I3MDS9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BMF (length=258 residues).
MPRAGVFWKQYRAVRSGLLRRPPESAAAAGPASGSRLPGSGVSLPQVFITLDPGAEPWHHDSEAETLSWSHPGEMEPPQC
VEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPC
GVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVWWQILLF
LHNLALNGDENRDRAGPR
>gnl|bcl2dbpro|W5N4P7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Lepisosteus oculatus GN=BMF (length=153 residues).
MEEDEDDVFHPSHFSHCWGTQFREIKYEDKGTQTPSPALVHGDNMLPCGVGAEPRRLFYGNAAFRLHFPAHFEQGGDEEE
ETGEAEEQPVRSAEVRIGQKLQRIGDQFHRDYLHMYRRNQRNHQPMWWRLALALFTFLFERQGNRNQLRGDQR
>gnl|bcl2dbpro|G3T7Z4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Loxodonta africana GN=BMF (length=268 residues).
MPRAGVFWKQYRTVLSLVHQRPPALAAAAVRSPRLPPLPAELFPSFPIESGRQAPRVLVTLDPGAEPWRHDPETDTLSWS
HPGEMEPSQCVEELEDDVFQPEEGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADHFHRLHMQRHQQNR
NPAWRQILQFLHHLAVNGEENRNGAGPR
>gnl|bcl2dbpro|G7PAW6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca fascicularis GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|G7PAW6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca fascicularis GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|F7CM09_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca mulatta GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEQNRNGAGPR
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6B5G4_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Macaca nemestrina GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K5Z4C3_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mandrillus leucophaeus GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A2K5Z4C3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mandrillus leucophaeus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|G1NHG8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Meleagris gallopavo GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
>gnl|bcl2dbpro|A0A1U8CPE0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mesocricetus auratus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQSEDGEPGTQPGSLLSADPFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRDRAW
WQVFLFLQNLALNREENREGVGPW
>gnl|bcl2dbpro|A0A1U8CPE0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mesocricetus auratus GN=BMF (length=189 residues).
IFPGEMEPPQCVEELEDDVFQSEDGEPGTQPGSLLSADPFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQN
RDRAWWQVFLFLQNLALNREENREGVGPW
>gnl|bcl2dbpro|F6X3N6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Monodelphis domestica GN=BMF (length=184 residues).
MEPPHYVEELEDDVFHPEDSEPGAQPGGLTSAALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPASFPASLRLGEEPPEEQWEHRAEVQIAQKLQCIADQFHRLHMQRHQQNRNHVW
WQILLFLHNLALNREENRNGAGPR
>gnl|bcl2dbpro|A2AV74_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=271 residues).
MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPIECGHQAPRVFFTLDPGAEPWHHNSEAETLS
WSHPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLS
PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQ
QNRDRAWWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|A2AV74_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Mus musculus GN=BMF (length=190 residues).
MSPGEMEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSP
ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQ
NRDRAWWQVFLFLQNLALNRQENREGVGPW
>gnl|bcl2dbpro|M3YAD5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Mustela putorius furo GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGDQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|G1PAU1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Myotis lucifugus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDELGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQWQHHRAEIQIARKLQSIADQFHRLQMQQHQQNRNRMW
WQFLLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A2I3HD83_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Nomascus leucogenys GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQEWGRP
>gnl|bcl2dbpro|I3K2D6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oreochromis niloticus GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRARR
QEIAEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAALLSLLFDRGFIAGGGGG
GRR
>gnl|bcl2dbpro|G1SR62_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Oryctolagus cuniculus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPQSLLSADPFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPANFALGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHLQQHQQNRNRVW
WQILLFLHNLALNGDENRDGAGPR
>gnl|bcl2dbpro|H0WYH6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Otolemur garnettii GN=BMF (length=182 residues).
MEPSQCVEELEDDVFQPEDGELGTGNVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGV
MLPCGVTEEPQRLFYGNVGYRLPLPASFPAGLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQ
VLFFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|W5QFV1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ovis aries GN=BMF (length=188 residues).
LTGEMEPPQCVEELEDDVFQPEDGEPGAQPRRLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPA
SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNR
NRMWWQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A2R9BS98_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pan paniscus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2R9BS98_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Pan paniscus GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|A0A2J8QDD5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pan troglodytes GN=BMF (length=129 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
>gnl|bcl2dbpro|A0A2J8QDD5_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Pan troglodytes GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A096NTE9_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=129 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGP
>gnl|bcl2dbpro|A0A096NTE9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=206 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGVDPRYKNARRSVRKLKASSFLSCQPE
>gnl|bcl2dbpro|A0A096NTE9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Papio anubis GN=BMF (length=196 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGVDPRPLTWNGAVVKPC
>gnl|bcl2dbpro|K7FRX2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pelodiscus sinensis GN=BMF (length=193 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDDFGLTGQPGEMTPTGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQT
LSPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHEPPVGFALNPHLQEEPREGHQEARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQILLFLHNLALNVEANRNHIGQR
>gnl|bcl2dbpro|A0A096LRV0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Poecilia formosa GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVAEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFHRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A2J8T301_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pongo abelii GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQSGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPTGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6FFR1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Propithecus coquereli GN=BMF (length=184 residues).
MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNQNRMW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6FFR1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Propithecus coquereli GN=BMF (length=130 residues).
MEPSHCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSHVVADPPLPTQPCFERRREQERGRSQ
>gnl|bcl2dbpro|Q8K589_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rattus norvegicus GN=BMF (length=185 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPVSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSALGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHMQQHQQNRDRA
WRQVFLFLQNLALNRRENREGVGPW
>gnl|bcl2dbpro|A0A2K6L933_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6L933_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=204 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMCL
>gnl|bcl2dbpro|A0A2K6L933_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus bieti GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6RAW8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus roxellana GN=BMF (length=123 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRRE
>gnl|bcl2dbpro|A0A2K6RAW8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus roxellana GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6TW86_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSCVVAGPPLPAQPGFEWRRKQEWGRSE
>gnl|bcl2dbpro|A0A2K6TW86_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A2K6TW86_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|G3WDQ2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sarcophilus harrisii GN=BMF (length=184 residues).
MESPHYVEELEDDVFHPEDSEPGAQPGGLTSPALFAQSQPDYMLDGLQLFPLTHCCGPGLRSVGQEDKATQTLSPASPSQ
GVMLPCGVTEEPHRLFYGNAGYRLPLPANFPSSLRLGAEPPEEQWEHRAEVQIARKLQCIADQFHRLHMQRHQQNQNHVW
WQILLFLHNLALNREENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=157 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQEFPSWLG
>gnl|bcl2dbpro|H0ZMX5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Taeniopygia guttata GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQR
>gnl|bcl2dbpro|A0A1U7UD37_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Tarsius syrichta GN=BMF (length=129 residues).
MDPSQCVEELEDDVFQPEDGESGTQSGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSHVVADTLLPTQPRFEWRREQERGRS
>gnl|bcl2dbpro|A0A1U7UD37_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Tarsius syrichta GN=BMF (length=184 residues).
MDPSQCVEELEDDVFQPEDGESGTQSGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRHTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPFGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMW
WQILFFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A3KND0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xenopus laevis GN=BMF (length=117 residues).
MDELDDDVFYPDAFGYPDQTITSSSLFNQSQSYTCLLGRFHLFPFSHCCGPGCRGTDNEDKATQTLGSPSQDIMLPCGVS
ETPQRLFYGKEALSEIYRMFNASIPHESHRFHRLFQV
>gnl|bcl2dbpro|F6TGJ4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xenopus tropicalis GN=BMF (length=181 residues).
QESYLNMDELDDDVFYPDEFGYPDQTMTSSTVFNQSQSYTCLLSRFHLFPLSHCCGPGCRGADYEDKATQTLGSPSISQD
IMLPCGVSETPQRLFYGHAGYLLYLPQNSPARFGEEVDNRRQEQSAEHRIARKLQCIGDQFHRFHLQRLQQNRNQFWSQI
LIFFRNLVMHPVGNRAGLAQR
© 1998-2018