Dataset for protein Bik of organism all

[Download (right click)] [Alignment] [Repertoires]

31 sequence(s)

>gnl|bcl2dbpro|A0A2K5CLG5_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Aotus nancymaae GN=BIK (length=155 residues).
MSEVRPLSSDILMETLLCEQFVHPLTMEVVGGSDPEEDLDPVEDPLECMENSDALVLQLACIADQMDVSLRARRLAQLYE
VAMYSPGLAFILDRTDIGDVLSGIVEVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
>gnl|bcl2dbpro|F7FUT7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Callithrix jacchus GN=BIK (length=155 residues).
MSEVRPLSSDIFMETLLCEQFVDPLTMEVVGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
VAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
>gnl|bcl2dbpro|F1PUF4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Canis lupus familiaris GN=BIK (length=149 residues).
MSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMY
SLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
>gnl|bcl2dbpro|H0W025_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cavia porcellus GN=BIK (length=158 residues).
MSEAKPVARDPLMETPLFEPPPGPLLAEGALGVTQPLWAEDLSPPGDTNLMECVEGSSLVALRLACIGDEMDLRLRSPRL
AQLPGRAVHSLAITYSQMGLWGVLGRLTLSLASLRDNVWACGRPASRAWVSPRWTCRWLLPVLLLLLLLLGTLRLLLQ
>gnl|bcl2dbpro|A0A2K5LDM6_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cercocebus atys GN=BIK (length=156 residues).
MSGVRPISRDTWMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFICDQTDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSHEQVLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A0D9QZY8_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Chlorocebus sabaeus GN=BIK (length=159 residues).
MSGVRPISRHILMESLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFIDGFTTLRENIMRFWRSLNPGSWVSREQVLLALLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5J4Q7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Colobus angolensis palliatus GN=BIK (length=160 residues).
MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLALLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A1S3FUQ7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Dipodomys ordii GN=BIK (length=149 residues).
MSEAGSVTRDLFIKTLLYQQMPGPRPAAGLFPITEPMGEEVWDPMDCLEGSNQVALWLVCIGDEMDQRLRSPRLAQLPGM
AIHSLALTYSQMGVWGVLRRLIRGVAHLRAHIRAWRPPIPRLQVSPGQVRRQMLPAVLLLCGALQLLLQ
>gnl|bcl2dbpro|F6RS78_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=80 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTDSQSPSPQGEGDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVY
>gnl|bcl2dbpro|G3QCT2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|Q13323_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Homo sapiens GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|I3LVX0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BIK (length=107 residues).
MVQGSHQVALRLACIGDEMDLCFQDLQLAQLPGMAMHSLALSYSQARVTGVLRSLAQGLASLRENMWFWRPAAPSTRVPP
ARACRELLPVLLLLGLLLSRALYLRLQ
>gnl|bcl2dbpro|A0A2K5VW94_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca fascicularis GN=BIK (length=160 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFNPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6DBJ4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca nemestrina GN=BIK (length=160 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECIEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5XSA1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mandrillus leucophaeus GN=BIK (length=156 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFLDGFTTLRENIMRFWRSPNPRSWVSREQVLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|O70337_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=150 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|O70337_BIK-04 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=106 residues).
MFTRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPD
QDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|O70337_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=150 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|G1S1X2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Nomascus leucogenys GN=BIK (length=159 residues).
MSEVRPISRDILMESLLYEQLLEPPTMEVLGVTDPEEDLDPMEDFDPLQCMEGSDALAPRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTFKENIIRLWRSPNPGSRVSREQMLLVLLVLLLLLLPLLSGGLYLLN
>gnl|bcl2dbpro|G1TZR9_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Oryctolagus cuniculus GN=BIK (length=152 residues).
MSEVRPGSRDLFQEALLDEQVPEPLLTAEVPGLTRPVEEGDLDLMECLEGSNQVALRLAYIGDEMDLHVRGLHTGPAAGV
AMHSLAFTYSQTGFTGVLGSVGLHLASLVELWSPWGRGAAAPAAVRPLPGQGWPPSWRVVLLGAGSWGLRMP
>gnl|bcl2dbpro|H0XAE7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Otolemur garnettii GN=BIK (length=147 residues).
MSAGRPVSMDHFMETFPFEQLLEPLTMEVLGMTEPNPMECLEDSDQVALRLACIGDEMDLHLRSPRLAQLSRMTMHSLGL
SYNQTDGQGVLRSVISGFTNLRENIAGFWRSLSRGPWVCPAPAWEQVLLLLLLLVLLLAGGLHLLLK
>gnl|bcl2dbpro|W5QCU2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ovis aries GN=BIK (length=148 residues).
MYQARPLSRNLFLYTFLQNHGPGFLDDQGSGLPGVTSILEFHPISPYSDSPHYLAMQLASIADEMELRLLLPQFVEPFWM
PMYSLCFPYSHVGLRDVLRSFMVAFTNLRENRRLWSFLTLRDRVSPSLWPELALSLLVVAMLSWGCRF
>gnl|bcl2dbpro|A0A2R8ZXD2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pan paniscus GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTESEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPRSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|H2QLU7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pan troglodytes GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|A0A096NKG5_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Papio anubis GN=BIK (length=160 residues).
MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLALLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|H2P4N6_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pongo abelii GN=BIK (length=125 residues).
MSEVRPISRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFSPLECMEGSDALALRLACIGDEMDVSLRAPRRAQL
PEVAMHSLGLAFIYDQTEDIRDVLRSFTDGFTTLKENIMRFWSSL
>gnl|bcl2dbpro|A0A2K6FM79_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Propithecus coquereli GN=BIK (length=152 residues).
MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSGCLEDSDEVALRLACIGDEMDLCLRSPRLAWLPGMTMH
SLGLALSCDQPVRWGVLGSLSDGFANLREYVARLWRSLSPRPWVCPAPAWEQVLLLLLVLLLLGGGLHLLLK
>gnl|bcl2dbpro|Q925D2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rattus norvegicus GN=BIK (length=158 residues).
MSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVALRLACIGDEMDRCLRSPRLV
QLPGIAMHRLAATYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ
>gnl|bcl2dbpro|A0A2K6MCW0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rhinopithecus bieti GN=BIK (length=157 residues).
MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFWRSLNPGSQVSREQVLLALLLLLAALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6QK74_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rhinopithecus roxellana GN=BIK (length=157 residues).
MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFWRSLNPGSQVSREQVLLALLLLLAALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6TBD7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BIK (length=155 residues).
MSEDRPLSSDILMETLLCEQFVDPLTMEVVGGSDPEEDPDSVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
VATYSPGLAFILDRTDIRDVLSGVVDVFADFQEDIVRLWRSLSSGSWVSGKQAVLLALLALLLAMFSGGLRLLLK
© 1998-2018