Dataset for protein Bim of organism all

[Download (right click)] [Alignment] [Repertoires]

262 sequence(s)

>gnl|bcl2dbpro|A0A3Q1ELG4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L11 (length=180 residues).
SSSAASPAAPHADTTEGGGADPEPVGAAGVSAKTSRSNSTGGEPDSPSWSRASLGVFQTRSIFHLPRRSSSGYFSADGSD
SVPSSPLSPKRLTADKTTQTPSPSGQVIRHALERMAGEAHRGGPETQRQQHGELNDCRSCGQRKTSLTFSAVVFALAIVC
PCLLSFLFTVCFRFCNKRVK
>gnl|bcl2dbpro|G1LDR8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A3Q1CI15_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Amphiprion ocellaris GN=BCL2L11 (length=182 residues).
PTKSGPDAAARCFTSGSRCRDSERLPPNPSHGSPDSPSWSRAQASLGVFQTRSIFHLPRRSSSGYFSADGADSVPSSPLS
PKRLTADKATQTPSPSGQVIKHALERMTDEAHGGGPGTQQHGELRLTYTREISCTFNLCNSFCTLFSVTVFCHLQSLFAS
TLQNVLIRFINPNYFSTFWNRC
>gnl|bcl2dbpro|A0A3P8RLE2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Amphiprion percula GN=BCL2L11 (length=197 residues).
ANRTPSLVGPEQKKRNGGNLRGGGADPEPVGAAGVSAKTSRLNSTGGEPDSPSWSRAQASLGVFQTRSIFHLPRRSSSGY
FSADGADSVPSSPLSPKRLTADKATQTPSPSGQVIKHALERMTDEAHGGGPGTQQHGELRLTYTREISCTFNLCNSFCTL
FSVTVFCHLQSLFASTLQNVLIRFINPNYFSTFWKRC
>gnl|bcl2dbpro|A0A3Q1ICY2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L11 (length=241 residues).
MDPRQPNRSDGSTAVTATGESGGDPPPVGAAGVSTPTSRSNDGGERRFGRPDSSGGGEPESQSRCRTKSSSSSDGLGVFR
SVFRLPRRSSSGYFSYDSDSQPSSPLSPRPVTFDRATQTPSPTGQVMNHALQRLAEANGSDLRTHQQHGSDLSSSSTQQQ
NAAGDMQAVEVGRELRRIGDDFNNHLLEVAGRHRWVGIQPIRLPHIHQDPTVLLCVGLLLFVIGRIIYSQGSTNSEGHSH
V
>gnl|bcl2dbpro|R4G9R5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anolis carolinensis GN=BCL2L11 (length=116 residues).
MLVVGSSQPQLCLLPKQLNVLSANAFAISCFLYRDVPWRRTGRRWCEAETSRWQSRPIPEDMQPEIWIAQELRRIGDEFN
ASHCPRRGFLDYQAVNHQIIILRLLHYIVRFIWRMQ
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=105 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGDISLWFRF
IFTFFDLYGHHHSQGTEQLHHKYFS
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATESSLG
IALRREVQWPLEWLAKSS
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMADWD
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLPSD
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5CAB2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Aotus nancymaae GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A3B1JXK6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Astyanax mexicanus GN=BCL2L11 (length=203 residues).
MSRPSNRATRPPFLKEQGERGQSGGGGGTLSRAEQCEQPEPGDGDPVRGPPALHNSLLGYQTRSPLFRTLSRSSSGYFSF
DSEPSSPLLMHSASTQTPSPSSQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYIAQELRRIGDEFN
DLYFRGAGRNGGGAQLPAQNEPAFILWMGLLIERLRQFLHRRR
>gnl|bcl2dbpro|Q2YDF0_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Bos taurus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|Q2YDF0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Bos taurus GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAY
YPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|Q2YDF0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bos taurus GN=BCL2L11 (length=171 residues).
MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPM
SCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVL
RYIVRLVWRMQ
>gnl|bcl2dbpro|F6XMC1_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|F6XMC1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=263 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYL
VLKDGGPVVKSALKLPWFHSPVA
>gnl|bcl2dbpro|F6XMC1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=203 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PAGMRPEIWIAQELRRIGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISG
NILQSVARWCQMMLTPQLYLVLKDGGPVVKSALKLPWFHSPVA
>gnl|bcl2dbpro|F6XMC1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|F6XMC1_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLLPD
>gnl|bcl2dbpro|F6XMC1_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|F6XMC1_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|F6XMC1_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=181 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGYRLTGQQPCLPWKVRGIGEKQEERVNPH
TWETFKSTRTHSLSARNSIHP
>gnl|bcl2dbpro|F6XMC1_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIRMDIGD
ISLWFRFTFTFFDLCGHHHSQGTEQQHKDFSW
>gnl|bcl2dbpro|J9NWV6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A452FCS1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAY
YPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A452FCS1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Capra hircus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A3G3M2M0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Carassius auratus GN=BCL2L11 (length=181 residues).
MSDTSREQTPGNVPASRGSGESAGVGAALRPGHFDFPQPSDGDPLRGGIAMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PGSPLLPNISEAQDDQNDEVWFAEPSHQHVQMAAPVGAMGPEISVARELRRIGDEFNRLYCQGAGAGGNNRAQLHAPNEH
AIIMWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A286XJN2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L11 (length=140 residues).
MAKQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAG
PPHLRPEIWIAQELRRIGDEFNASYPRRVFLNHYQPAEDQPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A286XJN2_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L11 (length=196 residues).
MAKQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQGNPEGAGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAGPPHLRPEIWIAQELRRIGDEFNAS
YPRRVFLNHYQPAEDQPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A286XJN2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L11 (length=196 residues).
MAKQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQGNPEGAGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAGPPHLRPEIWIAQELRRIGDEFNAS
YPRRVFLNHYQPAEDQPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLR
IALHREVQWPLECLASS
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAEL
LASST
>gnl|bcl2dbpro|A0A2K5NU92_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Cercocebus atys GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A0D9RWE0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2L11 (length=109 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRLEK
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
TSLWFGFIFTGLDLYGHHHSQDTEQLNHRDFS
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=88 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLR
IALHREVQ
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K5HZI7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Colobus angolensis palliatus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGVFE
>gnl|bcl2dbpro|B2KKY9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Danio rerio GN=BCL2L11 (length=176 residues).
MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVP
GSPLMPNISEAQDGQNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLRAPNEHAIVLW
MNVIIGRLVHFFLRRR
>gnl|bcl2dbpro|B8JK68_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Danio rerio GN=BCL2L11 (length=176 residues).
MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVP
GSPLMPNISEAQDGQNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLHAPNEHAIVLW
MNDIIGRLVHFFLRRR
>gnl|bcl2dbpro|A0A3Q2GRS5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Equus caballus GN=BCL2L11 (length=233 residues).
MFPAAAAGAARARGAARGALGCPAERGGGGRAASGRLCAVLAPLSASPGLCLPRCLSGDNQGAPGRRKARAGRRGARART
RRSEGKGRIKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQIEQQDRSPAPMSCDKSTQTPSPPCQAFNHY
LSAMASMRQSQAVPADMRPEVWIAQELRRIGDEFNASYPRRVVLNHHQAAEAHPQMIILRLLRYIIRLVRRLQ
>gnl|bcl2dbpro|A0A3P8XIA2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Esox lucius GN=BCL2L11 (length=132 residues).
RESSCEGNQQSRGGIMMPTNSLLGFQSRSPLFRTTSTSSSGYFSFDCDSIPSSPLLRNNKSTQTPSPSSQVITHAMRPGD
MRPEILIGQELQRIGDEFNNLFIHGVSGCSKMPVLHHLIYKPYQGPHCIKLS
>gnl|bcl2dbpro|A0A3P8XIA2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Esox lucius GN=BCL2L11 (length=216 residues).
MFDSSRPQNRSNGTTTLIGRGKIGESHPCGGATSSSKLSDYPQSCEGNQQSRGGIMMPTNSLLGFQSRSPLFRTTSTSSS
GYFSFDCDSIPSSPLLRNNKSTQTPSPSSQVITHAMRRLSKPQDTWRGYEAWPTPHHPYRPRPPPIAGDMRPEILIGQEL
QRIGDEFNNLFIHGRLGARNGQVAQANLPQMHQEPAFLLWMGLLIGRLLQIIWRRR
>gnl|bcl2dbpro|A0A337SW42_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A337SW42_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A337SW42_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A337SW42_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=131 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLFE
>gnl|bcl2dbpro|A0A337SW42_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=136 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPFFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVRAIEEGVL
>gnl|bcl2dbpro|A0A337SW42_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Felis catus GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQASMRQPQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLA
RVPASYI
>gnl|bcl2dbpro|A0A3Q2SZH6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Fundulus heteroclitus GN=BCL2L11 (length=239 residues).
MVTLCSSNRPPNLRDGSTEVTPPEGTGGDPASSARTPRLSKHREGSCAQPPGAVTAAGGGGGEPDSDSPPRSISPNSLDV
FQRRSIFRKSSGYFSFDCESLPSTPLSPHPLTADKATQTASPTGQVMNHALQRMAAEHGGQPARILGLHGHSFSARQGNA
ARDMQPERFGRQLRAIGDEYNNHLMRMAGRQQRDMVPLNLMPHIQQEPVAMLCVGLLLLLIGRIMYLQGSTNSHDHSQV
>gnl|bcl2dbpro|A0A3Q2U844_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Gallus gallus GN=BCL2L11 (length=179 residues).
MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRRSPLLPRSSSGYFSF
EAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRGFLDNRAGNP
QVVILRLLHYIIRLIWRMQ
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
LSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLR
IALHREVQWPLEWLAKSS
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMPLPPD
>gnl|bcl2dbpro|A0A2I2YQ13_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|O43521_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|O43521_BCL2L11-24 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|O43521_BCL2L11-19 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|O43521_BCL2L11-18 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|O43521_BCL2L11-17 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=82 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLP
PD
>gnl|bcl2dbpro|O43521_BCL2L11-16 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|O43521_BCL2L11-15 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLR
IALHREVQWPLKWLAKSS
>gnl|bcl2dbpro|O43521_BCL2L11-11 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=75 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQVSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK
>gnl|bcl2dbpro|O43521_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=82 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLP
PD
>gnl|bcl2dbpro|O43521_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=80 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|O43521_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=109 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRLEK
>gnl|bcl2dbpro|O43521_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|O43521_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
LSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|Q6JTU4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=36 residues).
MRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK
>gnl|bcl2dbpro|O43521_BCL2L11-12 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|O43521_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|O43521_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMPLPPD
>gnl|bcl2dbpro|O43521_BCL2L11-13 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|O43521_BCL2L11-20 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|O43521_BCL2L11-21 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMPLPPD
>gnl|bcl2dbpro|O43521_BCL2L11-22 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=80 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|O43521_BCL2L11-23 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
LSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|O43521_BCL2L11-25 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=109 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRLEK
>gnl|bcl2dbpro|A0A287DFJ0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRESQAEPADMRPEIWIAQELRRIGDEFNLY
YPRRVFFNNYQPEDRPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|A0A287DFJ0_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRESQAE
PADMRPEIWIAQELRRIGDEFNLYYPRRVFFNNYQPEDRPQMVILRLLRCIIRLVWRMH
>gnl|bcl2dbpro|A0A3Q3B113_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Kryptolebias marmoratus GN=BCL2L11 (length=238 residues).
MRSPSRPPNLRDGSTEVKATEGSSGGAPPSAGAARGSAHATRPVRGRAPSAAGGEPESPACSSNPPAGLDVFRSRSIFRF
PRRSSSGYFSFEGDSLPSSPLSPKPVTAEKATQTPSPTGQVMNHALQRMAVEQGGGPGTHRLHGSSPNPSGTQARNAAGD
MEAESFGRHLRTIGDEYNRLLLLRRMAGRPRRNIVPLNLLPHIHQEPVAMLCVSLLLLLIGRLMYLQGCTNSQNNSQV
>gnl|bcl2dbpro|A0A3Q3ESW6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Labrus bergylta GN=BCL2L11 (length=237 residues).
MHRPSRPPNRLDGSPTVTESHGTRGDPPQTSRSDNSGGRNFGRTDSTGGGEPDSPSRCRFKPVSPVDSLGVFQKRSIFHL
PRRASSGYFSYDGDSLPSSPLSPRPLTADKATQTPSPSGQVMQHALQRMTEAHGGGPGTQQQYGHSPSLTSRRQRTAAGD
MQAEAIGRDLQRIGDDYNRLLLWRMAGRHGRPEVHPNPQPHIQPEPTMLLCTGLMILLIGWIIYLRGNTNSHDHSQV
>gnl|bcl2dbpro|M3XHJ5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Latimeria chalumnae GN=BCL2L11 (length=158 residues).
MPTEESLQFDKDQGTSDVISECGHLHPTQRPDQPPFVKQEGCYCIISPLSKVIALVRWRDRSLLSTLMGGLLLPPSPCPF
VTRSPFFIFMRRSLVLSTSSSGYFTFDSDIVHSPAPVSVHKATQTPSPSSQLIVHVQHCLAQREQHPETHGKNPLNFT
>gnl|bcl2dbpro|G3SU55_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Loxodonta africana GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQPPQLRPGAPTSLLTEPQGNPDGEGDSCPQGSPQGPQAPPASPGPFATRSPLFI
FVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQALPADLRPEIWIARELRRIGDEF
NAYYPRRAFLNNYQAAEDHPQMVILRLLRYIVRLVWR
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAEL
LASST
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLG
IALHREVQWPLEWLASS
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A2K5X2I7_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|F7HHA9_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|F7HHA9_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAEL
LASST
>gnl|bcl2dbpro|F7HHA9_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|F7HHA9_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=95 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLG
IALHREVQWPLEWLA
>gnl|bcl2dbpro|F7HHA9_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=75 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQVSLCCPSWSALVLSWLTATSNSQVQAVLLPQPPK
>gnl|bcl2dbpro|F7HHA9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|F7HHA9_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|F7HHA9_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|F7HHA9_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Macaca mulatta GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=137 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTDPGPFATRSPCDKSTQTPSPPCQAFNHYLSAMASRRQAEPAD
MRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6E226_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Macaca nemestrina GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAEL
LASST
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLG
IALHREVQWPLECLASS
>gnl|bcl2dbpro|A0A2K5Z8B6_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Mandrillus leucophaeus GN=BCL2L11 (length=111 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A3Q3SYA1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mastacembelus armatus GN=BCL2L11 (length=145 residues).
MATEESGDPPAGDPRVSAQTSRSNGGTDQSSVSPSRGRTRSIAHLDSLSVFHTRSIFQLPRRSSSGYFSSDGDSLPSSPL
SPRPVTADKATQTPSLTSQVMNHALQRLAEAHGGGAGAHRQHGEHKHLRSRLFTAHAEYTQVKQP
>gnl|bcl2dbpro|G1MV54_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Meleagris gallopavo GN=BCL2L11 (length=72 residues).
FLLCAASRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPRRGFLDNHAGNPQVVILRLLHYIIRLIWRMQ
>gnl|bcl2dbpro|F7CXT2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Monodelphis domestica GN=BCL2L11 (length=200 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQQLRPGAPTSIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIF
LRRSPLLPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQSIPADMRPEIWIAQELRRIGDEFN
ASYYPRRGFLDNNYQGAGDHHQMVILRLLRYIIRLVWRMQ
>gnl|bcl2dbpro|A0A3Q3K6I5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Monopterus albus GN=BCL2L11 (length=236 residues).
MHLSRPPNRSDGSTAVTATEESGDPPSVGAAGTSAQSSRSNGGSERSFGHPGSAGGGEPVSPSRCRTKAIAPLDSLSVFH
TRSIFHLPRRSSSGYFSNDSDSVPSSPLSPRPVTADKVTQTPSPSSQVMNHALQCMAEAHGGRPGTHRQDASSPSPSSAR
QQNAIRDMQAEAVGRELRRIGDDYNNHLLELADRRRRVVPRIHQELTIVLCVGILVLVIGQIILQGSINSQDNSQV
>gnl|bcl2dbpro|O54918_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=91 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDQLENLNQV
AQNIHGDAWYN
>gnl|bcl2dbpro|O54918_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=110 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVF
ANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=110 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVF
ANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O54918_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mus musculus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNET
YTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|M3YDI3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Mustela putorius furo GN=BCL2L11 (length=232 residues).
MFPAAAAGAARARGAARGALGCRTARGGGRAASGRLCAAPGALKASPRLCLPRFFRAEGQGAPGRRRTRAGRRGARARTR
RSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYL
SAMASRRQSQAVPADMRPEMWIAQELRRIGDEFNAYYPRRVFLNNYPAAEAHPQMIILRLLRYIIRLVWRLQ
>gnl|bcl2dbpro|G1PDJ5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Myotis lucifugus GN=BCL2L11 (length=70 residues).
SMQQSQALPVDMRPEMWIAQELRRIGDEFNNSYRNPRRDFLNVYREAEGHPQMVVLRLLRYILRLVWRRM
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDVGD
ISLWFGFIFTGLDLYGHHHSQDTEQFNHKDFS
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2I3HW02_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Nomascus leucogenys GN=BCL2L11 (length=92 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEAAGSSLE
VQWPFEWLAKSS
>gnl|bcl2dbpro|F7FTC8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ornithorhynchus anatinus GN=BCL2L11 (length=144 residues).
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQDRSPPPVSCDKSTQTPSPHCQAFNHYLSAMASIRQP
QSVPEDMRPEIWIAQELRRIGDEFNASYCPRRGLLDNNNPAGNNHQMGFVHLLRYIIRRVWRLQ
>gnl|bcl2dbpro|G1SSY0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BCL2L11 (length=194 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQSEPQGNPEGDRCAHGSPQGPLAPSASPGPFATRSPLFIFVRRS
SLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADTRPETWIAQELRRIGDEFNAYYP
RRVFLNNYPAAEEQPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|H0XW23_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Otolemur garnettii GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDREGGQLQPAERPPQLRPGAPTSLHTEPQGNPEGNPEVEGDRCPQGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADLRPEMWIAQELRRIGDE
FNAYYPTRVFLHNYQAAEDHPQMVILRLLRYIVRLVWRLH
>gnl|bcl2dbpro|W5PY58_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ovis aries GN=BCL2L11 (length=195 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAY
YPRRVFVRHQAIEGHPQMVLLRVLRYLVRLVWRMQ
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLR
IALHREVQWPLKWLAKSS
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
LSLCFGFIFTGLDLYGHHHSQDAEQLNHKDFS
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMPLPPD
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=84 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LSST
>gnl|bcl2dbpro|A0A2R9CA99_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Pan paniscus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
LSLCFGFIFTGLDLYGHHHSQDAEQLNHKDFS
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMPLPPD
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A2J8JCT2_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Pan troglodytes GN=BCL2L11 (length=98 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLR
IALHREVQWPLKWLAKSS
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLG
IALHREVQWPLEWLASS
>gnl|bcl2dbpro|A0A2I3M6I1_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Papio anubis GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A3B3QC78_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Paramormyrops kingsleyae GN=BCL2L11 (length=190 residues).
MGQILLTIPCSVCSAEDKITRMAESRNPVAEQTPIQAGPRTAKVPGQLQATPRFSTLSASSSGYHSLDISLPNSPFMTHN
KSTQTPSPSNHLVCIYLSSVTRTLSMLPDMRPEMLVARELRRIGDKFNDIYINGVSILLCPHCPLRPTAMGQGATLTPYP
GDNKNKESPLRSRSSWLHVRMGEVEQQEIV
>gnl|bcl2dbpro|K7GA86_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pelodiscus sinensis GN=BCL2L11 (length=225 residues).
MGRAGRGPGAAQSVQAPRRVPAFCPVAGGSERAAARFPAPAGADSERRGLAEELLLEPDSLLFRQSLSASYSLDAGKGDQ
MAKQPSDLNSECDGEGGQFQSIERPSQPQHLRPGAPTSIQTQYQDRSPVPMSCDKSTQTPSPPCQAFNHYLSAMGKQDHA
SRWESPSIREDMQPEIWIAQELRRIGDEFNASYCPRRGFLDNQAINHQIVLRLLHYIIRLIWRMQ
>gnl|bcl2dbpro|A0A3B3VNE0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Poecilia latipinna GN=BCL2L11 (length=243 residues).
MHSSRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSCAPQTGASTAGGGGGGGGGGGGEPDADSPPCSVSPASL
DVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSPTGQVMNHALQRMAVEHGGLGLHGHSPNHYSTI
NAARDMQSETFGRQLRAIGDDYNNHLMVRRMARRHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDH
SQV
>gnl|bcl2dbpro|A0A3B3YII5_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L11 (length=241 residues).
MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSCAPQAGASTAGGGGGGGGGGRGEPDSDSPPCSVSPASL
DVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSPTGQVMNHALQRMAVEHGGLGLHGHSPNHYSTI
NAARDMQSENFGRQLRAIGDDYNNHLMRMARRHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQ
V
>gnl|bcl2dbpro|A0A3B3YII5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Poecilia mexicana GN=BCL2L11 (length=241 residues).
MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSCAPQAGASTAGGGGGGGGGGRGEPDSDSPPCSVSPASL
DVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSPTGQVMNHALQRMAVEHGGLGLHGHSPNHYSTI
NAARDMQSENFGRQLRAIGDDYNNHLMRMARRHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHDHSQ
V
>gnl|bcl2dbpro|A0A3P9N073_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Poecilia reticulata GN=BCL2L11 (length=202 residues).
DPASSARTPRSSKHTERSCAPQAGASTAGGGGGGGRGEPDSDSPPCTVSPASLDVFRSRSIFRPPRRSSSGYFSFDCDSL
PSSPLSPHPVTADKTTQTPSPTGQVMNHALQRMAVEHEIPKLNVKGKEEKGGRGGAFVIIPKRETNQPILSCVLPVQLMI
QQFSHATSIGIKKRKRVGYDDDYYHYYIDCFFLKSVSKYDVA
>gnl|bcl2dbpro|H2P5E2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=200 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQADEDHPQMLILRLLRYIVRLVWRRH
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=140 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=174 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQFQAEPADMRPEIWIAQELRRIGDE
FNAYYPRRMPLPSD
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=135 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQGNPEGSREGEGDRCSHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6GE31_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Propithecus coquereli GN=BCL2L11 (length=87 residues).
MAKQPSDVGSECDREGGQLQSVERPPQLRPGAPTSLQTEPQASMRQFQAEPADMRPEIWIAQELRRIGDEFNAYYPRRLA
KCLVPSI
>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=219 residues).
LLSARKARFSVCPCSSPEDRIHHLPHYLRSNRAGRPAFLKEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNS
LLGYQSRSPLFRTLSRSSSGYFSFESEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGA
APAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAGMQALSNPVAFSILGLFRGH
>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=163 residues).
MQNSNYCCFEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSGYFSFESEPSSP
LLTSPSLSVCSTELWPLYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNELYFHGVSQLHGCVAGMQALSARDLHDQMF
ALS
>gnl|bcl2dbpro|A0A3B4BVX1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pygocentrus nattereri GN=BCL2L11 (length=202 residues).
MSRRSNRAGRPAFLKEQGESGQSSGAASSRAAEQCEQPEPGEGDPVRGGITMPNSLLGYQSRSPLFRTLSRSSSGYFSFE
SEPSSPLVTHSASTQTPSPSSQVITHALQRIAEARGNAQTFELWPLYNHHPPHGAAPAGDMRPESYVAQELRRIGDEFNE
LYFHGAGRNGGRVQLPAEEEPAFMLWLGLVIRRLLEVLLRRR
>gnl|bcl2dbpro|O88498_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L11 (length=140 residues).
MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEE
PEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|O88498_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Rattus norvegicus GN=BCL2L11 (length=196 residues).
MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNET
YTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=117 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
TSLWFGFIFTGLDLYVVWIYIYHHSQDTEQLNHRDFS
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K6KJP8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus bieti GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=117 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
TSLWFGFIFTGLDLYVVWIYIYHHSQDTEQLNHRDFS
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEEHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PAGMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLPPD
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=96 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLA
LRREVQCPLEWLAKSS
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMADWD
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K6TRZ5_BCL2L11-10 BCL2-like 11 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIRMDIGD
ISLWFRFIFTFFDLYGYHHSQGTEQLHHKYVS
>gnl|bcl2dbpro|G3W979_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sarcophilus harrisii GN=BCL2L11 (length=200 residues).
MAKQPSDLNSECDREGGQLQPTERPTQPQLRPGAPTSIQTQYQGNSGEGDSCSPSSPQGPFAPPTSPSPFATRSPLFIFV
RRSPLLPRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDTASMRQSQSIPADMRPEIWIAQELRRIGDEF
NASYPRRGFLDNNYQAADDHHQMVILRLLHYIIRLVWRMQ
>gnl|bcl2dbpro|A0A3B4V919_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Seriola dumerili GN=BCL2L11 (length=172 residues).
MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRGSTTRRCRWSPSAKPQFERQRRAEPWPPRLHRRRRARLAAPVQNHSH
LSCQHFSRRSSSGYFSFDSDSLPSSPLSPRPATVERTTQTPSPTSQVMKHALQRMAEAHGGGARMQQQHGELKPALLKHT
KMTSQCCQTHFC
>gnl|bcl2dbpro|A0A3B4XZH1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Seriola lalandi dorsalis GN=BCL2L11 (length=216 residues).
MKAQADGAALFIQQTTKPVRWLDRSNGKRGERRGSTTRRCRWSPGAKPQFERQRRAETIATSPGNSLGVFQKRSIFSYPR
RSSSGYFSFDSDSLPTSPLSPRPATAERTTQTPSPTSQVMKHALQRMAEAHGGGARMQQQQHGEHRHFASGDMQAEAVGQ
ELRRIGDDFNRLLLLRVSHHRWCVCVCVCVCACGCVCACGCVCGCVRVCGGGGGVE
>gnl|bcl2dbpro|C1KGB8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVM
LFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|F1SU81_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=183 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|F1SU81_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=127 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|F1SU81_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMVILRLLRYIARLVWRMQ
>gnl|bcl2dbpro|A0A452SBG5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ursus americanus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQDV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIIRLVWRLQ
>gnl|bcl2dbpro|A0A452U4S4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ursus maritimus GN=BCL2L11 (length=84 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDLWTVERHL
ETAL
>gnl|bcl2dbpro|Q4KMV9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L11 (length=194 residues).
MAKQPSVLSPDCNSGEGGQLQSTSRQHSHRPLRRGAPTSLSSPFQGNQSDEGGSSSASTPWGPTISPYSPSSFVNRSPHC
MLVRGSSLVSKTSSGYFSFEVSPGPVSCDKSTQTPSPPCQAFNHLLSAMADRNPVNQMSPELWIAQELRRIGDDFNASFS
PRRGIFNNLPRPLDNDQVIILRVLRFIIRLILRL
>gnl|bcl2dbpro|A0A3B5M375_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Xiphophorus couchianus GN=BCL2L11 (length=209 residues).
MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRAPQAGASTAGGGGGGEGEGRRGEPDSDSPPC
SVSPASLDVFRSRSIFRPTRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVEHGGLGLQGEQ
TSVLPPPPSETSTTWEQIAVNIGPVLFIRPIPMLVPIYHASTLRISALE
>gnl|bcl2dbpro|A0A3B5QAM1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L11 (length=244 residues).
MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRAPQAGASTAGGGGGGEGGGRRGEPDSDSPPCSVSPAS
LDVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVEHGGLGLHGQSPNHYST
INAARDMQSETYGRQLRAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHD
HSQV
>gnl|bcl2dbpro|A0A3B5QAM1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L11 (length=250 residues).
MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRAPQAGASTAGGGGGGEGGGRRGEPDSDSPPC
SVSPASLDVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVEHGGLGLHGQS
PNHYSTINAARDMQSETYGRQLRAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQG
NTSSHDHSQV
© 1998-2019