Dataset for protein Noxa of organism Xiphophorus maculatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5RFA9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=PMAIP1 (length=40 residues).
LPAAAELCARELRQVGDKLYWRYKLLEMLLKNYETLNKIK
© 1998-2019