Dataset for protein classical BH3-containing proteins of organism Xiphophorus maculatus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3B5Q2N7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Xiphophorus maculatus GN=BAD (length=166 residues).
MDTKFTISDGESDPSEDVEERGDLQLMQEKEKPLSQRHTLTLPELRSTTGRVRLNSESIASTISREVELQARGEEEVGTP
TEGFPFRGRSLSAPPSLWAAKKYGRQLRRMSDEFVNLLDKGEMRNVSSDGSNRPIHHSRSWWSYLFSHQETEGENNHHEN
HASRTE
>gnl|bcl2dbpro|A0A3B5QAM1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L11 (length=244 residues).
MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRAPQAGASTAGGGGGGEGGGRRGEPDSDSPPCSVSPAS
LDVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVEHGGLGLHGQSPNHYST
INAARDMQSETYGRQLRAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHD
HSQV
>gnl|bcl2dbpro|A0A3B5QAM1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L11 (length=250 residues).
MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRAPQAGASTAGGGGGGEGGGRRGEPDSDSPPC
SVSPASLDVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVEHGGLGLHGQS
PNHYSTINAARDMQSETYGRQLRAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQG
NTSSHDHSQV
>gnl|bcl2dbpro|A0A3B5QK08_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xiphophorus maculatus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEASIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3B5QK08_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Xiphophorus maculatus GN=BMF (length=160 residues).
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPGQALHNGMLPCGVVEEPRRLFYGNAGFRLHFPAHFELVGDFDARQ
QEEQNRMEQLPLHQPAALSLEASIGQKLQLIGDQFHREHLQQYQQNQRNQGPLWWRMTAALLSLLFDRGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3B5RFA9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=PMAIP1 (length=40 residues).
LPAAAELCARELRQVGDKLYWRYKLLEMLLKNYETLNKIK
© 1998-2019