Dataset for protein Bim of organism Xiphophorus maculatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B5QAM1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L11 (length=244 residues).
MHSLRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRAPQAGASTAGGGGGGEGGGRRGEPDSDSPPCSVSPAS
LDVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVEHGGLGLHGQSPNHYST
INAARDMQSETYGRQLRAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQGNTSSHD
HSQV
>gnl|bcl2dbpro|A0A3B5QAM1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Xiphophorus maculatus GN=BCL2L11 (length=250 residues).
MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRAPQAGASTAGGGGGGEGGGRRGEPDSDSPPC
SVSPASLDVFRSRSIFRPPRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVEHGGLGLHGQS
PNHYSTINAARDMQSETYGRQLRAIGDEYNNLLMGRRMARGHQRNIVPLNLMPHIQQEPVAMLCVCLLLLLVGRIMYMQG
NTSSHDHSQV
© 1998-2019