Dataset for protein Bim of organism Xiphophorus couchianus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5M375_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Xiphophorus couchianus GN=BCL2L11 (length=209 residues).
MLTVTLCSSNRPPNLLDGSTEVTPAEGTGGDPASSARTPRSSKHTERSRAPQAGASTAGGGGGGEGEGRRGEPDSDSPPC
SVSPASLDVFRSRSIFRPTRRSSSGYFSFDCDSLPSSPLSPHPVTADKATQTPSLTGQVMNHALQRMAVEHGGLGLQGEQ
TSVLPPPPSETSTTWEQIAVNIGPVLFIRPIPMLVPIYHASTLRISALE
© 1998-2019