Dataset for protein Bad of organism Xiphophorus couchianus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5L9R9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Xiphophorus couchianus GN=BAD (length=149 residues).
MDTKFTISDGESDPSEDVEERGDLQLMQEKEKPLSQRHTLTLPELRSTKVELQARGEEEVGTPTEGFPFRGRSLSAPPSL
WAAKKYGRQLRRMSDEFVNLLDKGEMRNVSSDGSNRPIHHSRSWWSYLFSHQETEGENNHHENHASRTE
© 1998-2019