Dataset for protein classical BH3-containing proteins of organism Xenopus tropicalis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|F6TGJ4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xenopus tropicalis GN=BMF (length=181 residues).
QESYLNMDELDDDVFYPDEFGYPDQTMTSSTVFNQSQSYTCLLSRFHLFPLSHCCGPGCRGADYEDKATQTLGSPSISQD
IMLPCGVSETPQRLFYGHAGYLLYLPQNSPARFGEEVDNRRQEQSAEHRIARKLQCIGDQFHRFHLQRLQQNRNQFWSQI
LIFFRNLVMHPVGNRAGLAQR
>gnl|bcl2dbpro|F6Z067_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Xenopus tropicalis GN=BAD (length=151 residues).
MADSSPSAVFKLEEFDNEEQGLPLPFVDPPRGAGVRQPVAKSSPSLRRYPGKESRLRTESASESSETDKVGELHPFRSRS
RSAPSSMIATKYGRELRRMSDEFEKSFTGLPRPKSASAAGQMTGNRSIRDLIMGLFSRRKSKGRDESGDEE
>gnl|bcl2dbpro|Q4KMV9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Xenopus tropicalis GN=BCL2L11 (length=194 residues).
MAKQPSVLSPDCNSGEGGQLQSTSRQHSHRPLRRGAPTSLSSPFQGNQSDEGGSSSASTPWGPTISPYSPSSFVNRSPHC
MLVRGSSLVSKTSSGYFSFEVSPGPVSCDKSTQTPSPPCQAFNHLLSAMADRNPVNQMSPELWIAQELRRIGDDFNASFS
PRRGIFNNLPRPLDNDQVIILRVLRFIIRLILRL
© 1998-2018