Dataset for protein Bad of organism Xenopus tropicalis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F6Z067_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Xenopus tropicalis GN=BAD (length=151 residues).
MADSSPSAVFKLEEFDNEEQGLPLPFVDPPRGAGVRQPVAKSSPSLRRYPGKESRLRTESASESSETDKVGELHPFRSRS
RSAPSSMIATKYGRELRRMSDEFEKSFTGLPRPKSASAAGQMTGNRSIRDLIMGLFSRRKSKGRDESGDEE
© 1998-2018