Dataset for protein Bmf of organism Xenopus laevis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A3KND0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Xenopus laevis GN=BMF (length=117 residues).
MDELDDDVFYPDAFGYPDQTITSSSLFNQSQSYTCLLGRFHLFPFSHCCGPGCRGTDNEDKATQTLGSPSQDIMLPCGVS
ETPQRLFYGKEALSEIYRMFNASIPHESHRFHRLFQV
© 1998-2018