Dataset for protein classical BH3-containing proteins of organism Ursus maritimus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A384D070_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ursus maritimus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRDGAGPR
>gnl|bcl2dbpro|A0A384DJL2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ursus maritimus GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAHPQGQPASSNHHGGAGAVEPRSRHSSYPAGT
EEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLG
RGGSAPSQ
>gnl|bcl2dbpro|A0A452TE71_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ursus maritimus GN=PMAIP1 (length=53 residues).
WGSLLSGEPASPSPSAAPPPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A452U4S4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ursus maritimus GN=BCL2L11 (length=84 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDLWTVERHL
ETAL
>gnl|bcl2dbpro|A0A452V3L2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ursus maritimus GN=BIK (length=177 residues).
MAWSSEEARSREEMSHTGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWM
LPRVGELPGMAMYSLAFTYNQTGLRGVLRSLMDGLTNLRENIRIWSFLTFRNRGLDLEPSLPATQPQSRSSRCSDSPPPA
GLVRSCPLPAAPSGPHD
© 1998-2019