Dataset for protein Bmf of organism Ursus maritimus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A384D070_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ursus maritimus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRDGAGPR
© 1998-2019