Dataset for protein Bik of organism Ursus maritimus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452V3L2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ursus maritimus GN=BIK (length=177 residues).
MAWSSEEARSREEMSHTGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWM
LPRVGELPGMAMYSLAFTYNQTGLRGVLRSLMDGLTNLRENIRIWSFLTFRNRGLDLEPSLPATQPQSRSSRCSDSPPPA
GLVRSCPLPAAPSGPHD
© 1998-2019