Dataset for protein Bim of organism Ursus maritimus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452U4S4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ursus maritimus GN=BCL2L11 (length=84 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDLWTVERHL
ETAL
© 1998-2019