Dataset for protein classical BH3-containing proteins of organism Ursus americanus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A452QUG1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ursus americanus GN=BIK (length=146 residues).
FHTTRRCAQRVVAPSLHHQHPAGEGAVLTGAGGICQATGPLCNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLA
FTYNQTGLRGVLRSLMDGLTNLRENIRIWSFLTFRNRVSPHPGRRLVLSLLLLLGLLLGWGFRLLQ
>gnl|bcl2dbpro|A0A452RJM6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ursus americanus GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAQPQGQPASSNHHGGAGAVEPRSRHSSYPAGT
EEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLG
RGGSAPSQ
>gnl|bcl2dbpro|A0A452SBG5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ursus americanus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQDV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIIRLVWRLQ
>gnl|bcl2dbpro|A0A452SED0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ursus americanus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRDGAGPR
>gnl|bcl2dbpro|A0A452STA4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ursus americanus GN=PMAIP1 (length=54 residues).
MPGKKARKSAQASPARTPAEPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
© 1998-2019