Dataset for protein Bmf of organism Ursus americanus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452SED0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ursus americanus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRDGAGPR
© 1998-2019