Dataset for protein Bik of organism Ursus americanus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A452QUG1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ursus americanus GN=BIK (length=146 residues).
FHTTRRCAQRVVAPSLHHQHPAGEGAVLTGAGGICQATGPLCNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLA
FTYNQTGLRGVLRSLMDGLTNLRENIRIWSFLTFRNRVSPHPGRRLVLSLLLLLGLLLGWGFRLLQ
© 1998-2019