Dataset for protein classical BH3-containing proteins of organism Tursiops truncatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2U4BC98_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Tursiops truncatus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPAEGQWQHRAEVQIARKLQRIADQFHRLHMQQHQQNRNRVW
WQILLFLHNLALNGDENRNGAGPR
© 1998-2019