Dataset for protein Bad of organism Tetraodon nigroviridis

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H3D8J8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Tetraodon nigroviridis GN=BAD (length=140 residues).
MAAKFSLCSDSDSEPSEEVEEGERGSFSTSGRIRVNSESQASAVSRDEELQGNGDDEAGTPTDGAPFRGRSRSAPPALWA
AKKYGRQLRRMSDEFDSLLDKGGMRKTSSAGSARQMHHSRSWWSYLFSHQETESENNHHD
© 1998-2018