Dataset for protein classical BH3-containing proteins of organism Takifugu rubripes

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3B5K831_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Takifugu rubripes GN=BAD (length=168 residues).
MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTGTSRTRVSSESQASTFSREEELQGNVEDEAG
TPTEGAPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSHQETEGENGHH
DGHTHRTE
>gnl|bcl2dbpro|A0A3B5KWG6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Takifugu rubripes GN=BMF (length=147 residues).
MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGEAGDTLHYTGGAPNGMEPLPQQ
GPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWRLGTALLSLLFDRGFVAGGGGAGRR
© 1998-2019