Dataset for protein Bmf of organism Takifugu rubripes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5KWG6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Takifugu rubripes GN=BMF (length=147 residues).
MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGEAGDTLHYTGGAPNGMEPLPQQ
GPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWRLGTALLSLLFDRGFVAGGGGAGRR
© 1998-2019