Dataset for protein Bad of organism Takifugu rubripes

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3B5K831_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Takifugu rubripes GN=BAD (length=168 residues).
MATRFSISSDSDSDPSEEVDEGERNSSLSEQERQVLQRHTLTLPELRLTGTSRTRVSSESQASTFSREEELQGNVEDEAG
TPTEGAPFRGRSRSAPPALWAAQRYGRQLRRMSDEFDSLLDKGGMRKTNSTGSTKPMHHSRSWWSYLFSHQETEGENGHH
DGHTHRTE
© 1998-2019