Dataset for protein Noxa of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A287AZR7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=72 residues).
LSKETFMAKGKVLFASMPHRSSNKNTQTNPLRLALPPLPAVKCRIGLRRVGTKLAIRQQITNFIIFFFFLGP
>gnl|bcl2dbpro|F1SMU1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=121 residues).
ARAAAGAPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPT
RVALPPDPEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT
>gnl|bcl2dbpro|Q9GL49_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=176 residues).
MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGSFGPPPAAVRGNQPTSEAFGRSGCCFSSSLP
LARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQFRRIGDKLNF
RQKLLNLIAKLFRLGT
© 1998-2018