Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

16 sequence(s)

>gnl|bcl2dbpro|A0A287A5N9_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Sus scrofa GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSASRLGLRSSAAQLTAARLKALGDELHQRTMWRRSARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A287AEF3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=117 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGTDPQAPASPGARPQATWGKLVTSRGSRPAAATMEALGLWRPGVATALTQRGP
RRMKGLRMRSSAPSAADRSRRPPSSGLHSVMAASSGG
>gnl|bcl2dbpro|A0A287AEF3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=208 residues).
MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPASQSMFQIPEFEQSEQEDSSPADRGLGPSPTGTDPQPWRT
APGHLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSD
EFQGSFKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
>gnl|bcl2dbpro|A0A287AIU8_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=157 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQEFPSWLG
>gnl|bcl2dbpro|A0A287AIU8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AZR7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=72 residues).
LSKETFMAKGKVLFASMPHRSSNKNTQTNPLRLALPPLPAVKCRIGLRRVGTKLAIRQQITNFIIFFFFLGP
>gnl|bcl2dbpro|C1KGB8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVM
LFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|F1RM01_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|F1SMU1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=121 residues).
ARAAAGAPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPT
RVALPPDPEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT
>gnl|bcl2dbpro|F1SU81_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMVILRLLRYIARLVWRMQ
>gnl|bcl2dbpro|F1SU81_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=127 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|F1SU81_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=183 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|Q9GL49_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=176 residues).
MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGSFGPPPAAVRGNQPTSEAFGRSGCCFSSSLP
LARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQFRRIGDKLNF
RQKLLNLIAKLFRLGT
© 1998-2018