Dataset for protein Bmf of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A287AIU8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=157 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQEFPSWLG
© 1998-2018