Dataset for protein Puma of organism Sus scrofa

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F1RM01_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2018